Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Agitoxin-2

Agitoxin-2 is a potent and selective blocker of the Shaker type voltage-gated Kv1.3 and Kv1.1 channels. Agitoxin-2 inhibits Kv1.3 with an IC50 value of around 200 pM and Kv1.1 with an IC50 value of around 140 pM. This peptide toxin was originally isolated from the venom of the Israeli scorpion L. quinquestriatus hebraeus.

Product Specifications

CAS Number

168147-41-9

Specifications

Blocker of Kv1.1 and Kv1.3 channels

Target

K channels

Sequence

GVPINVSCTGSPQCIKPCKDAGMRFGKCMNRKCHCTPK

Peptide Number

13AGI002

Disulfide Bonds

Cys8-Cys28; Cys14-Cys33; Cys18-Cys35

N Terminal Sequence

H

C Terminal Sequence

OH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C8orf1 (Oxidative Stress-induced Growth Inhibitor 2, hT41, OSGIN2) (PE)
124158-PE 100 µL

C8orf1 (Oxidative Stress-induced Growth Inhibitor 2, hT41, OSGIN2) (PE)

Sign In for Pricing
View Details
Mouse Monoclonal ENPP-3/CD203c Antibody (NP4D6) [PE/Cy5.5]
FAB5756PECY55 0.1 mL

Mouse Monoclonal ENPP-3/CD203c Antibody (NP4D6) [PE/Cy5.5]

Sign In for Pricing
View Details
DROSHA Rabbit Polyclonal Antibody (HRP)
orb2605248 100 µg

DROSHA Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
Frozen Tissue Blocks, Ileum
CB539618 1 Block

Frozen Tissue Blocks, Ileum

Sign In for Pricing
View Details
Mouse Monoclonal S100A13 Antibody (S100A13/7484) [Janelia Fluor 525]
NBP3-27005JF525 0.1 mL

Mouse Monoclonal S100A13 Antibody (S100A13/7484) [Janelia Fluor 525]

Sign In for Pricing
View Details
Enzalutamide Impurity 55
RM-E261255-01 10 mg

Enzalutamide Impurity 55

Sign In for Pricing
View Details