Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Agitoxin-2

Agitoxin-2 is a potent and selective blocker of the Shaker type voltage-gated Kv1.3 and Kv1.1 channels. Agitoxin-2 inhibits Kv1.3 with an IC50 value of around 200 pM and Kv1.1 with an IC50 value of around 140 pM. This peptide toxin was originally isolated from the venom of the Israeli scorpion L. quinquestriatus hebraeus.

Product Specifications

CAS Number

168147-41-9

Specifications

Blocker of Kv1.1 and Kv1.3 channels

Target

K channels

Sequence

GVPINVSCTGSPQCIKPCKDAGMRFGKCMNRKCHCTPK

Peptide Number

13AGI002

Disulfide Bonds

Cys8-Cys28; Cys14-Cys33; Cys18-Cys35

N Terminal Sequence

H

C Terminal Sequence

OH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal HLA-DR Antibody (TAL 1B5) [FITC]
NB600-989F 0.1 mL

Mouse Monoclonal HLA-DR Antibody (TAL 1B5) [FITC]

Sign In for Pricing
View Details
URB1 Protein Lysate (Rat) with C-HA Tag
49245036 100 µg

URB1 Protein Lysate (Rat) with C-HA Tag

Sign In for Pricing
View Details
Zfp239 (NM_008616) Mouse Recombinant Protein
PM48340M5 20 µg

Zfp239 (NM_008616) Mouse Recombinant Protein

Sign In for Pricing
View Details
Ethyl 3-imino-2- (propan-2-yl) -2,3-dihydro-1H-pyrazole-4-carboxylate
QEC62360-01 50 mg

Ethyl 3-imino-2- (propan-2-yl) -2,3-dihydro-1H-pyrazole-4-carboxylate

Sign In for Pricing
View Details
Ethyl 3-imino-2- (propan-2-yl) -2,3-dihydro-1H-pyrazole-4-carboxylate
QEC62360-02 0.5 g

Ethyl 3-imino-2- (propan-2-yl) -2,3-dihydro-1H-pyrazole-4-carboxylate

Sign In for Pricing
View Details
DCDC2 (NM_016356) Human Tagged Lenti ORF Clone
RC208721L1 10 µg

DCDC2 (NM_016356) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details