Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ADWX-1

ADWX-1 is an optimised synthetic analog of the scorpion peptide BmKTx. ADWX-1 is known to block voltage-gated Kv1.3 channel with a high affinity (IC50 = 1.89 pM) and selectivity (340 fold greater affinity than for voltage-dependent) . ADWX-1 inhibits CD4+ CCR7– T-cell proliferation. ADWX-1 is an interesting therapeutic candidate to treat auto-immune disorders such as multiple sclerosis, type-1 diabetes, rheumatoid arthritis and psoriasis. This peptide is a valuable tool for studying the structure-function of Kv1.3 channel and auto-immunity pathways

Product Specifications

Specifications

Kv1.3 channel blocker

Target

K channels

Sequence

VGINVKCKHSRQCLKPCKDAGMRFGKCTNGKCHCTPK

Peptide Number

13ADW001

Disulfide Bonds

Cys7-Cys27; Cys13-Cys32; Cys17-Cys34

N Terminal Sequence

H

C Terminal Sequence

OH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL28 Receptor alpha (IFNLR1) (NM_173065) Human Untagged Clone
SC306781 10 µg

IL28 Receptor alpha (IFNLR1) (NM_173065) Human Untagged Clone

Sign In for Pricing
View Details
Cytokeratin 8, acetylated (K483) discontinued
340383-01 100 µL

Cytokeratin 8, acetylated (K483) discontinued

Sign In for Pricing
View Details
Cytokeratin 8, acetylated (K483) discontinued
340383-02 200 µL

Cytokeratin 8, acetylated (K483) discontinued

Sign In for Pricing
View Details
Anti-p107/RBL1 Antibody Picoband® Fluoro647 Conjugated
PA1894-Fluoro647 100 µg/Vial

Anti-p107/RBL1 Antibody Picoband® Fluoro647 Conjugated

Sign In for Pricing
View Details
RANGRF Adenovirus (Rat)
38484056 1.0 mL

RANGRF Adenovirus (Rat)

Sign In for Pricing
View Details
Rabbit Polyclonal KPNA5 Antibody
NBP1-52978 100 µL

Rabbit Polyclonal KPNA5 Antibody

Sign In for Pricing
View Details