ADWX-1
ADWX-1 is an optimised synthetic analog of the scorpion peptide BmKTx. ADWX-1 is known to block voltage-gated Kv1.3 channel with a high affinity (IC50 = 1.89 pM) and selectivity (340 fold greater affinity than for voltage-dependent) . ADWX-1 inhibits CD4+ CCR7– T-cell proliferation. ADWX-1 is an interesting therapeutic candidate to treat auto-immune disorders such as multiple sclerosis, type-1 diabetes, rheumatoid arthritis and psoriasis. This peptide is a valuable tool for studying the structure-function of Kv1.3 channel and auto-immunity pathways
Product Specifications
Specifications
Kv1.3 channel blocker
Target
K channels
Sequence
VGINVKCKHSRQCLKPCKDAGMRFGKCTNGKCHCTPK
Peptide Number
13ADW001
Disulfide Bonds
Cys7-Cys27; Cys13-Cys32; Cys17-Cys34
N Terminal Sequence
H
C Terminal Sequence
OH
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
bsm-90429R-01 50 µL
Mechanistic Target Of Rapamycin Kinase Recombinant Antbody Kit (KD-Validated)
Sign In for Pricing
View Details bsm-90429R-02 50μL Ab + 25μg cell Lysate + 25μg WT cell
Mechanistic Target Of Rapamycin Kinase Recombinant Antbody Kit (KD-Validated)
Sign In for Pricing
View Details 
MBS1244647-01 0.05 mg (E-Coli)
Recombinant Lachancea thermotolerans ATPase GET3 (GET3)
Sign In for Pricing
View Details MBS1244647-02 0.05 mg (Yeast)
Recombinant Lachancea thermotolerans ATPase GET3 (GET3)
Sign In for Pricing
View Details MBS1244647-03 0.05 mg (Baculovirus)
Recombinant Lachancea thermotolerans ATPase GET3 (GET3)
Sign In for Pricing
View Details