Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ρ-Da1a (AdTx1)

AdTx1 (rho-Da1a – ρ-Da1a) is a 65 amino-acid peptide originally isolated from the venom of the green mamba, an African snake (Dendroaspis angusticep) . AdTx1 is stabilized by four disulfide bridges and belongs to the family of the three-finger-fold peptide. AdTx1 has subnanomolar affinity (K (i) = 0.35 nM) and high specificity for the human alpha (1A) -adrenoceptor subtype and is 1000 times more potent on this subtype than on other adrenoceptor subtypes. AdTx1 is a potent relaxant of smooth muscles.

Product Specifications

Specifications

Selective antagonist of the alpha (1A) -adrenoceptor

Target

GPCR

Sequence

LTCVTSKSIFGITTEDCPDGQNLCFKRRHYVVPKIYDSTRGCAATCPIPENYDSIHCCKTDKCNE

Peptide Number

ADT001

Disulfide Bonds

Cys3-Cys24; Cys17-Cys42; Cys46-Cys57; Cys58-Cys63

N Terminal Sequence

H

C Terminal Sequence

OH

More Discoveries

Explore Other Products

Browse additional items from our catalog

Adra2b ORF Vector (Rat) (pORF)
ORF063138 1.0 µg DNA

Adra2b ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
Mouse Pancreastatin ELISA Kit
MBS728010-01 48 Well

Mouse Pancreastatin ELISA Kit

Sign In for Pricing
View Details
Mouse Pancreastatin ELISA Kit
MBS728010-02 96 Well

Mouse Pancreastatin ELISA Kit

Sign In for Pricing
View Details
Mouse Pancreastatin ELISA Kit
MBS728010-03 5x 96 Well

Mouse Pancreastatin ELISA Kit

Sign In for Pricing
View Details
Mouse Pancreastatin ELISA Kit
MBS728010-04 10x 96 Well

Mouse Pancreastatin ELISA Kit

Sign In for Pricing
View Details
Rabbit Anti-BACH1 antibody
SL8768R-01 50 µL

Rabbit Anti-BACH1 antibody

Sign In for Pricing
View Details