Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ρ-Da1a (AdTx1)

AdTx1 (rho-Da1a – ρ-Da1a) is a 65 amino-acid peptide originally isolated from the venom of the green mamba, an African snake (Dendroaspis angusticep) . AdTx1 is stabilized by four disulfide bridges and belongs to the family of the three-finger-fold peptide. AdTx1 has subnanomolar affinity (K (i) = 0.35 nM) and high specificity for the human alpha (1A) -adrenoceptor subtype and is 1000 times more potent on this subtype than on other adrenoceptor subtypes. AdTx1 is a potent relaxant of smooth muscles.

Product Specifications

Specifications

Selective antagonist of the alpha (1A) -adrenoceptor

Target

GPCR

Sequence

LTCVTSKSIFGITTEDCPDGQNLCFKRRHYVVPKIYDSTRGCAATCPIPENYDSIHCCKTDKCNE

Peptide Number

ADT001

Disulfide Bonds

Cys3-Cys24; Cys17-Cys42; Cys46-Cys57; Cys58-Cys63

N Terminal Sequence

H

C Terminal Sequence

OH

More Discoveries

Explore Other Products

Browse additional items from our catalog

c-Jun (JUN) Mouse Monoclonal Antibody [Clone ID: OTI1G4]
TA800611S 30 µL

c-Jun (JUN) Mouse Monoclonal Antibody [Clone ID: OTI1G4]

Sign In for Pricing
View Details
BAG3 Recombinant Antibody
bsm-61540R-TR 20 µL

BAG3 Recombinant Antibody

Sign In for Pricing
View Details
MS4A4A (Biotin)
569202-01 50 µg

MS4A4A (Biotin)

Sign In for Pricing
View Details
MS4A4A (Biotin)
569202-02 100 µg

MS4A4A (Biotin)

Sign In for Pricing
View Details
Mmu-miR-6918-5p miRNA Inhibitor
orb1869617-01 10 nmol

Mmu-miR-6918-5p miRNA Inhibitor

Sign In for Pricing
View Details
Mmu-miR-6918-5p miRNA Inhibitor
orb1869617-02 20 nmol

Mmu-miR-6918-5p miRNA Inhibitor

Sign In for Pricing
View Details