Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TAMRA-ShK

TMR-ShK is a fluorescent (red) derivative of the well-known ShK toxin (Stichodactyla helianthus neurotoxin) isolated from the venom of the Carribean sea anemone Stoichactis helianthus. Wild-type ShK blocks potently Kv1.3 (KCNA3), Kv1.1 (KCNA1), Kv1.4 (KCNA4) and Kv1.6 (KCNA6) with a Kd value of 11 pM, 16 pM, 312 pM and 165 pM, respectively. The fluorescent TMR-labeled ShK blocks Kv1.3 and Kv1.1 with Kd values of 52 pM and 397 pM, respectively. TMR-ShK can be used to identify lymphocytes expressing Kv1.3 channels such as effective memory T cells (TEM) in the case of autoimmune diseases (type 1 diabetes, mellitus or rheumatoid arthritis) which overexpress Kv1.3 channels.

Product Specifications

Specifications

Selective blocker of Kv1.4

Target

K channels

Sequence

RSCIDTIPKSRCTAFQCKHSMKYRLSFCRKTCGTC

Peptide Number

SAT001

Disulfide Bonds

Cys3-Cys35; Cys12-Cys28; Cys17-Cys32

N Terminal Sequence

H

C Terminal Sequence

OH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

COVID-19 S Protein Delta (L452R, T478K) -6His VLP
VLP018 1x 10^8 VP/mL - 200 μL

COVID-19 S Protein Delta (L452R, T478K) -6His VLP

Sign In for Pricing
View Details
MSC siRNA (Mouse)
MBS8233815-01 15 nmol

MSC siRNA (Mouse)

Sign In for Pricing
View Details
MSC siRNA (Mouse)
MBS8233815-02 30 nmol

MSC siRNA (Mouse)

Sign In for Pricing
View Details
MSC siRNA (Mouse)
MBS8233815-03 5x 30 nmol

MSC siRNA (Mouse)

Sign In for Pricing
View Details
Vmp1 3'UTR GFP Stable Cell Line
TU172107 1.0 mL

Vmp1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Lentiviral mouse Ankrd40 shRNA (UAS) - Lentiviral mouse Ankrd40 shRNA (UAS, iRFP) plasmid
GTR15297307 1 Vial

Lentiviral mouse Ankrd40 shRNA (UAS) - Lentiviral mouse Ankrd40 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details