Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ShK – Stichodactyla toxin

ShK (Stichodactyla helianthus Neurotoxin) has been isolated from the venom of the Carribean sea anemone Stoichactis helianthus. ShK inhibits voltage-dependent potassium channels. It blocks Kv1.3 (KCNA3) potently and also Kv1.1 (KCNA1), Kv1.4 (KCNA4) and Kv1.6 (KCNA6) respectively with a Kd of 11 pM, 16 pM, 312 pM and 165 pM. Interestingly, it was also demonstrated that ShK potently inhibits the hKv3.2b channel with an IC50 value of approximately 0.6 nM

Product Specifications

CAS Number

165168-50-3

Specifications

Selective blocker of Kv1.3

Target

K channels

Sequence

RSCIDTIPKSRCTAFQCKHSMKYRLSFCRKTCGTC

Peptide Number

08SHK001

Disulfide Bonds

Cys3-Cys35; Cys12-Cys28; Cys17-Cys32

N Terminal Sequence

H

C Terminal Sequence

OH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

WAY 181187 10mg
A14163-10 10 mg

WAY 181187 10mg

Sign In for Pricing
View Details
Human P53 Antibody-BIOTIN
MBS856656-01 0.1 mg

Human P53 Antibody-BIOTIN

Sign In for Pricing
View Details
Human P53 Antibody-BIOTIN
MBS856656-02 5x 0.1 mg

Human P53 Antibody-BIOTIN

Sign In for Pricing
View Details
ZNF398 CRISPR/Cas9 KO Plasmid (h)
sc-412829 20 µg

ZNF398 CRISPR/Cas9 KO Plasmid (h)

Sign In for Pricing
View Details
CTAG2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K0523808 1.0 µg DNA

CTAG2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Podocarpic acid (Standard)
HY-N2318R 1 Each

Podocarpic acid (Standard)

Sign In for Pricing
View Details