Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

8xHis-ProTx-II

His-tagged ProTx-II (ProTx-2, Protoxin II) which is a toxin that was originally isolated from Thrixopelma pruriens (Peruvian green velvet tarantula) . ProTx-II inhibits both tetrodotoxin-sensitive and tetrodotoxin-resistant voltage-gated sodium channels. ProTx-II inhibits activation by shifting the voltage-dependence of channel activation to more positive potentials. ProTx-II blocks Nav1.7 with an IC50 value of around 300 pM, Nav1.2, Nav1.5 and Nav1.6 with IC50 values of 41 nM, 79 nM and 26 nM respectively. It also acts on Cav3.1/CACNA1G and interacts more weakly with the related T-Type channel Cav3.2/CACNA1H but potently inhibits the L-type calcium channel Cav1.2/CACNA1C. ProTx-II blocks action potential propagation in nociceptors. 8xHis-ProTx-II is a polyhistidine tagged version of ProTx-II.

Product Specifications

Specifications

Nav1.7 selective blocker

Target

Na channels

Sequence

HHHHHHHHYCQKWMWTCDSERKCCEGMVCRLWCKKKLW

Peptide Number

PTH002

Disulfide Bonds

Cys2-Cys16; Cys9-Cys21; Cys15-Cys25

N Terminal Sequence

H

C Terminal Sequence

OH

More Discoveries

Explore Other Products

Browse additional items from our catalog

PLEK Recombinant Antibody, AbBy Fluor™ 488 Conjugated
bsm-62626R-BF488 100 µL

PLEK Recombinant Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details
AHSA1 (Activator of 90kD Heat Shock Protein ATPase Homolog 1, AHA1, p38, HSPC322, C14orf3)
123092 50 µg

AHSA1 (Activator of 90kD Heat Shock Protein ATPase Homolog 1, AHA1, p38, HSPC322, C14orf3)

Sign In for Pricing
View Details
2,2,2-Trifluoro-N- (3-hydroxyphenyl) acetamide
PC1002832-01 100 mg

2,2,2-Trifluoro-N- (3-hydroxyphenyl) acetamide

Sign In for Pricing
View Details
2,2,2-Trifluoro-N- (3-hydroxyphenyl) acetamide
PC1002832-02 1 g

2,2,2-Trifluoro-N- (3-hydroxyphenyl) acetamide

Sign In for Pricing
View Details
4-butyl-2-methylaniline hydrochloride
OR27510 1 Each

4-butyl-2-methylaniline hydrochloride

Sign In for Pricing
View Details
Dmap1 Mouse qPCR Primer Pair (NM_023178)
MP203753 200 Reactions

Dmap1 Mouse qPCR Primer Pair (NM_023178)

Sign In for Pricing
View Details