8xHis-ProTx-II
His-tagged ProTx-II (ProTx-2, Protoxin II) which is a toxin that was originally isolated from Thrixopelma pruriens (Peruvian green velvet tarantula) . ProTx-II inhibits both tetrodotoxin-sensitive and tetrodotoxin-resistant voltage-gated sodium channels. ProTx-II inhibits activation by shifting the voltage-dependence of channel activation to more positive potentials. ProTx-II blocks Nav1.7 with an IC50 value of around 300 pM, Nav1.2, Nav1.5 and Nav1.6 with IC50 values of 41 nM, 79 nM and 26 nM respectively. It also acts on Cav3.1/CACNA1G and interacts more weakly with the related T-Type channel Cav3.2/CACNA1H but potently inhibits the L-type calcium channel Cav1.2/CACNA1C. ProTx-II blocks action potential propagation in nociceptors. 8xHis-ProTx-II is a polyhistidine tagged version of ProTx-II.
Product Specifications
Specifications
Nav1.7 selective blocker
Target
Na channels
Sequence
HHHHHHHHYCQKWMWTCDSERKCCEGMVCRLWCKKKLW
Peptide Number
PTH002
Disulfide Bonds
Cys2-Cys16; Cys9-Cys21; Cys15-Cys25
N Terminal Sequence
H
C Terminal Sequence
OH
Explore Other Products
Browse additional items from our catalog
SLC45A2 (Solute Carrier Family 45 Member 2, 1A1, AIM1, Membrane-associated Transporter Protein, MATP, Melanoma Antigen AIM1, Protein AIM-1, SHEP5) (APC)