Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ProTx-II

ProTx-II (ProTx-2, Protoxin II) is a toxin that was originally isolated from Thrixopelma pruriens (Peruvian green velvet tarantula) . ProTx-II inhibits both tetrodotoxin-sensitive and tetrodotoxin-resistant voltage-gated sodium channels. ProTx-II inhibits activation by shifting the voltage-dependence of channel activation to more positive potentials. ProTx-II blocks Nav1.7 with an IC50 value of around 300 pM, Nav1.2, Nav1.5 and Nav1.6 with IC50 values of 41 nM, 79 nM and 26 nM respectively. It also acts on Cav3.1/CACNA1G and interacts more weakly with the related T-Type channel Cav3.2/CACNA1H but potently inhibits the L-type calcium channel Cav1.2/CACNA1C. ProTx-II blocks action potential propagation in nociceptors.

Product Specifications

CAS Number

484598-36-9

Specifications

Nav1.7 selective blocker

Target

Na channels

Sequence

YCQKWMWTCDSERKCCEGMVCRLWCKKKLW

Peptide Number

07PTX002

Disulfide Bonds

Cys2-Cys16; Cys9-Cys21; Cys15-Cys25

N Terminal Sequence

H

C Terminal Sequence

OH

More Discoveries

Explore Other Products

Browse additional items from our catalog

CITED2 Peptide
MBS3229214-01 0.1 mg

CITED2 Peptide

Sign In for Pricing
View Details
CITED2 Peptide
MBS3229214-02 5x 0.1 mg

CITED2 Peptide

Sign In for Pricing
View Details
1-[4- (Chloromethyl) -2-methylphenyl]piperidine hydrochloride
PZC05619-01 50 mg

1-[4- (Chloromethyl) -2-methylphenyl]piperidine hydrochloride

Sign In for Pricing
View Details
1-[4- (Chloromethyl) -2-methylphenyl]piperidine hydrochloride
PZC05619-02 0.5 g

1-[4- (Chloromethyl) -2-methylphenyl]piperidine hydrochloride

Sign In for Pricing
View Details
P73 (Ab-99) Antibody
E021075-2 100 µg -100 µL

P73 (Ab-99) Antibody

Sign In for Pricing
View Details
Fluorescent Universal Lateral Flow Kit (Qdot)
AU2037-02 3 Lines

Fluorescent Universal Lateral Flow Kit (Qdot)

Sign In for Pricing
View Details