Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cy5-ProTx-I

Cy5-ProTx-I (Protoxin 1; β-theraphotoxin-Tp1a) is a fluorescently labeled ProTx-I that was originally isolated from the venom of Thrixopelma pruriens (Peruvian green velvet tarantula) . This toxin reversibly inhibits the tetrodotoxin (TTX) -resistant channel Nav1.8 (IC50 = 27 nM) and Nav1.2, Nav1.5 and Nav1.7 with IC50 values between 50 and 100 nM. Furthermore, ProTx-I shifts the voltage dependence activity of T-type Cav3.1 channels (IC50= 50 nM) without affecting the voltage dependence of inactivation. ProTx-I is a valuable tool to discriminate between Cav3.1 and Cav3.2. ProTx-I is also an antagonist of TRAP1.

Product Specifications

Specifications

Blocker of voltage-gated sodium channels and T-type Cav

Target

Na channels

Sequence

YCQKWMWTCDSERKCCEGMVCRLWCKKKLW

Peptide Number

PTF001

Disulfide Bonds

Cys2-Cys16; Cys9-Cys21; Cys15-Cys28

N Terminal Sequence

Cy5

C Terminal Sequence

OH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DEFB106B Adenovirus (Human)
17919051 1.0 mL

DEFB106B Adenovirus (Human)

Sign In for Pricing
View Details
Pig Thyroid Stimulating Hormone (TSH) ELISA Kit
abx353424-01 96 Tests

Pig Thyroid Stimulating Hormone (TSH) ELISA Kit

Sign In for Pricing
View Details
Pig Thyroid Stimulating Hormone (TSH) ELISA Kit
abx353424-02 5x 96 Tests

Pig Thyroid Stimulating Hormone (TSH) ELISA Kit

Sign In for Pricing
View Details
Pig Thyroid Stimulating Hormone (TSH) ELISA Kit
abx353424-03 10x 96 Tests

Pig Thyroid Stimulating Hormone (TSH) ELISA Kit

Sign In for Pricing
View Details
Anti-GABA-A-R, Alpha1 Antibody FL490 Conjugate
75-136-FL490 200 µL

Anti-GABA-A-R, Alpha1 Antibody FL490 Conjugate

Sign In for Pricing
View Details
Livin Polyclonal Antibody, Cy5 Conjugated
bs-20731R-Cy5 100 µL

Livin Polyclonal Antibody, Cy5 Conjugated

Sign In for Pricing
View Details