Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cy5-ProTx-I

Cy5-ProTx-I (Protoxin 1; β-theraphotoxin-Tp1a) is a fluorescently labeled ProTx-I that was originally isolated from the venom of Thrixopelma pruriens (Peruvian green velvet tarantula) . This toxin reversibly inhibits the tetrodotoxin (TTX) -resistant channel Nav1.8 (IC50 = 27 nM) and Nav1.2, Nav1.5 and Nav1.7 with IC50 values between 50 and 100 nM. Furthermore, ProTx-I shifts the voltage dependence activity of T-type Cav3.1 channels (IC50= 50 nM) without affecting the voltage dependence of inactivation. ProTx-I is a valuable tool to discriminate between Cav3.1 and Cav3.2. ProTx-I is also an antagonist of TRAP1.

Product Specifications

Specifications

Blocker of voltage-gated sodium channels and T-type Cav

Target

Na channels

Sequence

YCQKWMWTCDSERKCCEGMVCRLWCKKKLW

Peptide Number

PTF001

Disulfide Bonds

Cys2-Cys16; Cys9-Cys21; Cys15-Cys28

N Terminal Sequence

Cy5

C Terminal Sequence

OH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-EEF1E1 antibody
PAab02649 100 µg

Anti-EEF1E1 antibody

Sign In for Pricing
View Details
Asah1 3'UTR GFP Stable Cell Line
TU250950 1.0 mL

Asah1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Lentiviral mouse Ptges3 shRNA (UAS) - Lentiviral mouse Ptges3 shRNA (UAS) (100)
GTR15252414 1 Vial

Lentiviral mouse Ptges3 shRNA (UAS) - Lentiviral mouse Ptges3 shRNA (UAS) (100)

Sign In for Pricing
View Details
PECAM1 Protein (C-6xHis tag, )
P512084 100 µg

PECAM1 Protein (C-6xHis tag, )

Sign In for Pricing
View Details
Recombinant human DARS protein
ATGP1454-100 100 µg

Recombinant human DARS protein

Sign In for Pricing
View Details
MUC5AC (E3O9I) XP® Rabbit Monoclonal Antibody (BSA and Azide Free)
CST 60100SF 100 µg

MUC5AC (E3O9I) XP® Rabbit Monoclonal Antibody (BSA and Azide Free)

Sign In for Pricing
View Details