Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Phrixotoxin-3

Phrixotoxin-3 (PaurTx3 or Beta-theraphotoxin-Ps1a) is a valuable pharmacological tool to study voltage-gated sodium channels. Phrixotoxin-3, originally issued from the venom of the tarantula phrixotrichus auratus, has been shown to inhibit Nav1.1, Nav1.2, Nav1.3, Nav1.4 and Nav1.5 with respective IC50 values of 610 nM, 0.6 nM, 42 nM, 288 nM and 72 nM. It is thus considered as one of the most potent and almost selective modulator of Nav1.2.

Product Specifications

Specifications

Selective blocker of Nav1.2

Target

Na channels

Sequence

DCLGFLWKCNPSNDKCCRPNLVCSRKDKWCKYQI

Peptide Number

13PHX003

Disulfide Bonds

Cys2-Cys17; Cys9-Cys23; ; Cys16-Cys30

N Terminal Sequence

H

C Terminal Sequence

OH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NG2 Recombinant Rabbit mAb
E47M52891 100 µL

NG2 Recombinant Rabbit mAb

Sign In for Pricing
View Details
Human Protein Wnt-3A, WNT3A ELISA KIT
E2349Hu-01 48 Well

Human Protein Wnt-3A, WNT3A ELISA KIT

Sign In for Pricing
View Details
Human Protein Wnt-3A, WNT3A ELISA KIT
E2349Hu-02 96 Well

Human Protein Wnt-3A, WNT3A ELISA KIT

Sign In for Pricing
View Details
Human Protein Wnt-3A, WNT3A ELISA KIT
E2349Hu-03 5x 96 Tests

Human Protein Wnt-3A, WNT3A ELISA KIT

Sign In for Pricing
View Details
Human Protein Wnt-3A, WNT3A ELISA KIT
E2349Hu-04 10x 96 Tests

Human Protein Wnt-3A, WNT3A ELISA KIT

Sign In for Pricing
View Details
Prpsap1 Rat shRNA Lentiviral Particle (Locus ID 64390)
TL710742V 500 µL Each

Prpsap1 Rat shRNA Lentiviral Particle (Locus ID 64390)

Sign In for Pricing
View Details