Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Phrixotoxin-3

Phrixotoxin-3 (PaurTx3 or Beta-theraphotoxin-Ps1a) is a valuable pharmacological tool to study voltage-gated sodium channels. Phrixotoxin-3, originally issued from the venom of the tarantula phrixotrichus auratus, has been shown to inhibit Nav1.1, Nav1.2, Nav1.3, Nav1.4 and Nav1.5 with respective IC50 values of 610 nM, 0.6 nM, 42 nM, 288 nM and 72 nM. It is thus considered as one of the most potent and almost selective modulator of Nav1.2.

Product Specifications

Specifications

Selective blocker of Nav1.2

Target

Na channels

Sequence

DCLGFLWKCNPSNDKCCRPNLVCSRKDKWCKYQI

Peptide Number

13PHX003

Disulfide Bonds

Cys2-Cys17; Cys9-Cys23; ; Cys16-Cys30

N Terminal Sequence

H

C Terminal Sequence

OH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FEZ2 Human siRNA Oligo Duplex (Locus ID 9637)
SR306413 1 Kit

FEZ2 Human siRNA Oligo Duplex (Locus ID 9637)

Sign In for Pricing
View Details
CBLC ORF Vector (Human) (pORF)
15107011 1.0 µg DNA

CBLC ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
HNRPUL1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV813762 1.0 µg DNA

HNRPUL1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
Anti-Myosin Light Chain 2 Rabbit pAb
GB11417-100 100 μL

Anti-Myosin Light Chain 2 Rabbit pAb

Sign In for Pricing
View Details
HLTF (G-6) Alexa Fluor® 546
sc-398357 AF546 200 µg/mL

HLTF (G-6) Alexa Fluor® 546

Sign In for Pricing
View Details
Actinin, alpha2/3 (Alpha-Actinin-2, Alpha-Actinin skeletal muscle Isoform 2, F-Actin cross-linking Protein, ACTN2, alpha-Actinin2, Actinin alpha2, Actininalpha2, alphaActinin-2, Alpha-Actinin-3, Alpha-Actinin skeletal muscle Isoform 3, ACTN3, alpha-Actinin3, Actinin alpha3, Actininalpha3, alphaActinin-3, Actinin-alpha3, alpha-Actinin-2, alpha-Actinin-3) discontinued
220571-01 50 µL

Actinin, alpha2/3 (Alpha-Actinin-2, Alpha-Actinin skeletal muscle Isoform 2, F-Actin cross-linking Protein, ACTN2, alpha-Actinin2, Actinin alpha2, Actininalpha2, alphaActinin-2, Alpha-Actinin-3, Alpha-Actinin skeletal muscle Isoform 3, ACTN3, alpha-Actinin3, Actinin alpha3, Actininalpha3, alphaActinin-3, Actinin-alpha3, alpha-Actinin-2, alpha-Actinin-3) discontinued

Sign In for Pricing
View Details