Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Phlotoxin-1

Phlotoxin-1 is a new member of the NaSpTx-1 family. Phlotoxin-1 has been purified originally from the venom of Phlogiellus sp., Theraphosidae Selenocosmiinae (endemic to Papua New Guinea) . Phlotoxin-1 inhibits Nav1.7 with an IC50 value of 39 ± 2 nM.

Product Specifications

Specifications

Blocker of Nav1.7 channel

Target

Na channels

Sequence

ACLGQWDSCDPKASKCCPNYACEWKYPWCRYKLF

Peptide Number

PHX001

Disulfide Bonds

Cys1-Cys4; Cys2-Cys5; Cys3-Cys6

N Terminal Sequence

H

C Terminal Sequence

OH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse anti-DYKDDDDK IgG, clone M2, primary antibody, Conjugated to Alkaline Phosphatase
MBS689642-01 0.1 mg

Mouse anti-DYKDDDDK IgG, clone M2, primary antibody, Conjugated to Alkaline Phosphatase

Sign In for Pricing
View Details
Mouse anti-DYKDDDDK IgG, clone M2, primary antibody, Conjugated to Alkaline Phosphatase
MBS689642-02 5x 0.1 mg

Mouse anti-DYKDDDDK IgG, clone M2, primary antibody, Conjugated to Alkaline Phosphatase

Sign In for Pricing
View Details
ABL1 (7B11) Antibody
252799 0.1 mL

ABL1 (7B11) Antibody

Sign In for Pricing
View Details
TMPPE Peptide - N-terminal region
MBS3232543-01 0.1 mg

TMPPE Peptide - N-terminal region

Sign In for Pricing
View Details
TMPPE Peptide - N-terminal region
MBS3232543-02 5x 0.1 mg

TMPPE Peptide - N-terminal region

Sign In for Pricing
View Details
ADCK4 Rabbit Polyclonal Antibody (APC-Cy5.5)
orb1601793 100 µL

ADCK4 Rabbit Polyclonal Antibody (APC-Cy5.5)

Sign In for Pricing
View Details