Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Phlotoxin-1

Phlotoxin-1 is a new member of the NaSpTx-1 family. Phlotoxin-1 has been purified originally from the venom of Phlogiellus sp., Theraphosidae Selenocosmiinae (endemic to Papua New Guinea) . Phlotoxin-1 inhibits Nav1.7 with an IC50 value of 39 ± 2 nM.

Product Specifications

Specifications

Blocker of Nav1.7 channel

Target

Na channels

Sequence

ACLGQWDSCDPKASKCCPNYACEWKYPWCRYKLF

Peptide Number

PHX001

Disulfide Bonds

Cys1-Cys4; Cys2-Cys5; Cys3-Cys6

N Terminal Sequence

H

C Terminal Sequence

OH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Calpain 9 (CAPN9) Antibody
abx111332 100 µL

Calpain 9 (CAPN9) Antibody

Sign In for Pricing
View Details
LOC100361814 3'UTR Luciferase Stable Cell Line
TU208096 1.0 mL

LOC100361814 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Lentiviral human GPR45 sgRNA gene knockout kit - Lentiviral human GPR45 sgRNA gene knockout kit (plasmid)
GTR15382820 1 Vial

Lentiviral human GPR45 sgRNA gene knockout kit - Lentiviral human GPR45 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
Recombinant Feline Thyrotropin Subunit Beta (TSHB), C-His
AP1C232-01 100 µg

Recombinant Feline Thyrotropin Subunit Beta (TSHB), C-His

Sign In for Pricing
View Details
Recombinant Feline Thyrotropin Subunit Beta (TSHB), C-His
AP1C232-02 500 µg

Recombinant Feline Thyrotropin Subunit Beta (TSHB), C-His

Sign In for Pricing
View Details
Visugromab Biosimilar - Research Grade
ICH5286-5mg 5 mg

Visugromab Biosimilar - Research Grade

Sign In for Pricing
View Details