Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OD1

OD1 is a scorpion peptide that has been isolated initially from the venom of the scorpion Odonthobuthus doriae. OD1 potently inhibits fast inactivation of mammalian channels Nav1.7 (EC50 4.5 nM), Nav1.4 (EC50 10 ± 2 nM) and Nav1.6 (EC50 47 ± 10 nM) . OD1 also blocks fast inactivation of the para/tipE insect channel (EC50 80 nM) . OD1 weakly affects mammalian Nav1.3 and Nav1.5 (EC50 > 1 μM) and does not affect Nav1.2 and Nav1.8. OD1 induces spontaneous pain when injected in animal in association with our without Veratridine and can be used to test the analgesic effects of Nav1.7 blockers in-vivo.

Product Specifications

Specifications

Nav1.7 channel activator

Target

Na channels

Sequence

GVRDAYIADDKNCVYTCASNGYCNTECTKNGAESGYCQWIGRYGNACWCIKLPDEVPIRIPGKCR

Peptide Number

ODX001

Disulfide Bonds

Cys13-Cys64; Cys17-Cys37; Cys23-Cys47; Cys27-Cys49

N Terminal Sequence

H

C Terminal Sequence

NH2

More Discoveries

Explore Other Products

Browse additional items from our catalog

TCHP Rabbit Polyclonal Antibody (PerCP)
orb2403310 100 µL

TCHP Rabbit Polyclonal Antibody (PerCP)

Sign In for Pricing
View Details
ECH1 Peptide
DF12970-BP 1 mg

ECH1 Peptide

Sign In for Pricing
View Details
CRYBB1 Protein Vector (Rat) (pPB-C-His)
PV261862 500 ng

CRYBB1 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
IGF2BP2 (NM_006548) Human Recombinant Protein
TP305673M 100 µg

IGF2BP2 (NM_006548) Human Recombinant Protein

Sign In for Pricing
View Details
AUP1 Double Nickase Plasmid (m)
sc-419272-NIC 20 µg

AUP1 Double Nickase Plasmid (m)

Sign In for Pricing
View Details
Lentiviral mouse Gtf2h2 shRNA (UAS) - Lentiviral mouse Gtf2h2 shRNA (UAS, RFP) plasmid
GTR15299068 1 Vial

Lentiviral mouse Gtf2h2 shRNA (UAS) - Lentiviral mouse Gtf2h2 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details