Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MitTx

MitTx is a peptide isolated from the Venom of the Texas coral snake Micrurus tener tener. MitTx is a selective agonist for acid-sensing ion channels 1 (ASIC1s) and produces a similar effect than pH drops. MitTx activates both ASIC1a & ASIC1b with a higher selectivity for ASIC1a (EC50 = 9.4 nM) compared to the ASIC1b (EC50= 23 nM) . MitTx also demonstrates an activity for ASIC3 with a lower potency (EC50=830 nM) .The venom toxin MitTx is an heterodimer composed of an α subunit of ~ 7 kDa and a β subunit of ~ 13.5 kDa. These two subunits when isolated do not present activity against ASIC channels. In vivo, the heterodimer elicits a robust pain-related behavior in mice by activation of ASIC1 channels on capsaicin-sensitive nerve fibers

Product Specifications

Specifications

ASIC1a/1b agonist

Target

ASIC channels

Sequence

MitTx-α subunit: QIRPAFCYEDPPFFQKCGAFVDSYYFNRSRITCVHFFYGQCDVNQNHFTTMSECNRVCHG MitTx-β subunit: NLNQFRLMIKCTNDRVWADFVDYGCYCVARDSNTPVDDLDRCCQAQKQCYDEAVKVHGCKPL VMFYSFECRYLASDLDCSGNNTKCRNFVCNCDRTATLCILTATYNRNNHKIDPSRCQ

Peptide Number

MTX002

Disulfide Bonds

Mit-αsubunit:Cys31-Cys82; Cys41-Cys65; Cys57-Cys78/Mit-βsubunit:Cys41-Cys100; Cys55-Cys148; Cys57-Cys73; Cys72-Cys130; Cys79-Cys123; Cys89-Cys116; Cys109-Cys121

N Terminal Sequence

H

C Terminal Sequence

OH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-HOXD12 Polyclonal Antibody
TMAB-07259-01 50 μL

Anti-HOXD12 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-HOXD12 Polyclonal Antibody
TMAB-07259-02 100 µL

Anti-HOXD12 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-HOXD12 Polyclonal Antibody
TMAB-07259-03 200 µL

Anti-HOXD12 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-SAPK4/MAPK13 Antibody Picoband® Fluoro550 Conjugated
PA1944-Fluoro550 100 µg/Vial

Anti-SAPK4/MAPK13 Antibody Picoband® Fluoro550 Conjugated

Sign In for Pricing
View Details
DPI (Diphenyleneiodonium chloride)
S8639-25mg 25 mg

DPI (Diphenyleneiodonium chloride)

Sign In for Pricing
View Details
Human SLC16A9 Pre-designed siRNA Set B
SI014888B 1 Each

Human SLC16A9 Pre-designed siRNA Set B

Sign In for Pricing
View Details