Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Margatoxin

Margatoxin (MgTx) is a component of the venom of Scorpio Centruroides margaritatus. Margatoxin preferentially inhibits voltage-dependent potassium channels Kv1.3 with an IC50 value around 50 pM (20 fold more potent than Charybdotoxin) and irreversibly inhibits the proliferation response of human T-cells at 20 µM concentration. Margatoxin is known to be less potent on Kv1.3 expressed in Xenopus Oocytes (IC50 around 1 nM) . Margatoxin was also described to be a potent inhibitor of human vascular smooth muscle cell migration with an IC50 of 85 pM.

Product Specifications

CAS Number

145808-47-5

Specifications

Kv1.3 selective blocker

Target

K channels

Sequence

TIINVKCTSPKQCLPPCKAQFGQSAGAKCMNGKCKCYPH

Peptide Number

08MAG001

Disulfide Bonds

Cys7-Cys29; Cys13-Cys34; Cys17-Cys36

N Terminal Sequence

H

C Terminal Sequence

OH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BTF3L4, CT (BTF3L4, Transcription factor BTF3 homolog 4, Basic transcription factor 3-like 4)
MBS6000016-01 0.2 mL

BTF3L4, CT (BTF3L4, Transcription factor BTF3 homolog 4, Basic transcription factor 3-like 4)

Sign In for Pricing
View Details
BTF3L4, CT (BTF3L4, Transcription factor BTF3 homolog 4, Basic transcription factor 3-like 4)
MBS6000016-02 5x 0.2 mL

BTF3L4, CT (BTF3L4, Transcription factor BTF3 homolog 4, Basic transcription factor 3-like 4)

Sign In for Pricing
View Details
PKM2 Antibody
MBS9613854-01 0.1 mL

PKM2 Antibody

Sign In for Pricing
View Details
PKM2 Antibody
MBS9613854-02 0.2 mL

PKM2 Antibody

Sign In for Pricing
View Details
PKM2 Antibody
MBS9613854-03 5x 0.2 mL

PKM2 Antibody

Sign In for Pricing
View Details
HSPB11 (Heat Shock Protein beta-11, Placental Protein 25, PP25, IFT25, C1orf41, HSPCO34) discontinued
211382-01 50 µL

HSPB11 (Heat Shock Protein beta-11, Placental Protein 25, PP25, IFT25, C1orf41, HSPCO34) discontinued

Sign In for Pricing
View Details