Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Margatoxin

Margatoxin (MgTx) is a component of the venom of Scorpio Centruroides margaritatus. Margatoxin preferentially inhibits voltage-dependent potassium channels Kv1.3 with an IC50 value around 50 pM (20 fold more potent than Charybdotoxin) and irreversibly inhibits the proliferation response of human T-cells at 20 µM concentration. Margatoxin is known to be less potent on Kv1.3 expressed in Xenopus Oocytes (IC50 around 1 nM) . Margatoxin was also described to be a potent inhibitor of human vascular smooth muscle cell migration with an IC50 of 85 pM.

Product Specifications

CAS Number

145808-47-5

Specifications

Kv1.3 selective blocker

Target

K channels

Sequence

TIINVKCTSPKQCLPPCKAQFGQSAGAKCMNGKCKCYPH

Peptide Number

08MAG001

Disulfide Bonds

Cys7-Cys29; Cys13-Cys34; Cys17-Cys36

N Terminal Sequence

H

C Terminal Sequence

OH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CRIP1 ELISA Kit (Human) (OKCD00326)
OKCD00326 96 Well

CRIP1 ELISA Kit (Human) (OKCD00326)

Sign In for Pricing
View Details
CD34 Polyclonal Antibody
A72914-050 50 µL

CD34 Polyclonal Antibody

Sign In for Pricing
View Details
PE/Dazzle™ 594 anti-human CD196 (CCR6)
GT13230 100 Tests

PE/Dazzle™ 594 anti-human CD196 (CCR6)

Sign In for Pricing
View Details
Rabbit Monoclonal PPIL1 Antibody (003) [PerCP]
NBP2-90270PCP 0.1 mL

Rabbit Monoclonal PPIL1 Antibody (003) [PerCP]

Sign In for Pricing
View Details
Human PAQR8 Protein Lysate 20ug
IHUPAQR8PLLY20UG 20 µg

Human PAQR8 Protein Lysate 20ug

Sign In for Pricing
View Details
Nkx3.1 (NKX3-1) Mouse Monoclonal Antibody [Clone ID: LBI7F6]
AMM16803VCF 100 µg

Nkx3.1 (NKX3-1) Mouse Monoclonal Antibody [Clone ID: LBI7F6]

Sign In for Pricing
View Details