Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Leiurotoxin-1

Scyllatoxin (Leiurotoxin-1) is a neurotoxin that was originally isolated from Leiurus quinquestriatus hebraeus. Scyllatoxin binds and blocks SK channels (small conductance Ca2+-activated K+ channels) in the brain and spinal cord and inhibits them.

Product Specifications

CAS Number

116235-63-3

Specifications

SK channels blocker

Target

K channels

Sequence

AFCNLRMCQLSCRSLGLLGKCIGDKCECVKH

Peptide Number

10LEI001

Disulfide Bonds

Cys3-Cys21; Cys8-Cys26; Cys12-Cys28

N Terminal Sequence

H

C Terminal Sequence

NH2

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Papain Type IV 2x Crystallized
183955-01 25 mg

Papain Type IV 2x Crystallized

Sign In for Pricing
View Details
Papain Type IV 2x Crystallized
183955-02 100 mg

Papain Type IV 2x Crystallized

Sign In for Pricing
View Details
Papain Type IV 2x Crystallized
183955-03 500 mg

Papain Type IV 2x Crystallized

Sign In for Pricing
View Details
TruStrip RDT Sheep IgG Rapid Test cards, 25/pk
7620-RDT-25 1 Pk

TruStrip RDT Sheep IgG Rapid Test cards, 25/pk

Sign In for Pricing
View Details
RING Finger Protein 212 (RNF212, Probable E3 SUMO-protein Ligase RNF212, ZHP3) (APC)
132687-APC 100 µL

RING Finger Protein 212 (RNF212, Probable E3 SUMO-protein Ligase RNF212, ZHP3) (APC)

Sign In for Pricing
View Details
BDP 630/650 tetrazine
orb2815065-01 50 mg

BDP 630/650 tetrazine

Sign In for Pricing
View Details