Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Latartoxin-1a

Latartoxin-1a (U1-zodatoxin-Lt1a, LtTx-1a) has been isolated from the venom of Lachesana tarabaevi spider. It has been described to have insecticidal properties by inducing paralysis and death in some insects.

Product Specifications

Specifications

Insects paralysis and death

Target

Insectisides

Sequence

ECIPTKHDCTNDRKNCCPGHECKCYNTQIGGSKKEQCGCKKSLLAKAKNFGGKVITIFKA

Peptide Number

LAT001

Disulfide Bonds

Cys1-Cys4; Cys2-Cys5; Cys3-Cys8; Cys6-Cys7

N Terminal Sequence

H

C Terminal Sequence

OH

More Discoveries

Explore Other Products

Browse additional items from our catalog

IFluor® 610 Anti-human CD44 Antibody *HI44a*
104400D0-AAT 100 Tests

IFluor® 610 Anti-human CD44 Antibody *HI44a*

Sign In for Pricing
View Details
Kitl Protein Vector (Mouse) (pPB-C-His)
PV194450 500 ng

Kitl Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
TOE1 Human qPCR Template Standard (NM_025077)
HK207507 1 Kit

TOE1 Human qPCR Template Standard (NM_025077)

Sign In for Pricing
View Details
Prenatal chromosomes probe
FP-314 1 Vial 100 μL (10-20 T)

Prenatal chromosomes probe

Sign In for Pricing
View Details
RPL13A Antibody
A33575-100UL 100 µL

RPL13A Antibody

Sign In for Pricing
View Details
Human RAB35 Recombinant Protein (N-His)
HC165012-01 50 µg

Human RAB35 Recombinant Protein (N-His)

Sign In for Pricing
View Details