Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Latartoxin-1a

Latartoxin-1a (U1-zodatoxin-Lt1a, LtTx-1a) has been isolated from the venom of Lachesana tarabaevi spider. It has been described to have insecticidal properties by inducing paralysis and death in some insects.

Product Specifications

Specifications

Insects paralysis and death

Target

Insectisides

Sequence

ECIPTKHDCTNDRKNCCPGHECKCYNTQIGGSKKEQCGCKKSLLAKAKNFGGKVITIFKA

Peptide Number

LAT001

Disulfide Bonds

Cys1-Cys4; Cys2-Cys5; Cys3-Cys8; Cys6-Cys7

N Terminal Sequence

H

C Terminal Sequence

OH

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olfr1271 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
32728064 1.0 µg DNA

Olfr1271 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
UBE2J2 Human Over-expression Lysate
orb1375245 20 µg

UBE2J2 Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Human NUDT5 Protein, His, E.coli-1mg
QP12907-1mg 1mg

Recombinant Human NUDT5 Protein, His, E.coli-1mg

Sign In for Pricing
View Details
IGLV2-5 sgRNA CRISPR Lentivector (Human) (Target 3)
K1064304 1.0 µg DNA

IGLV2-5 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Anti-Escherichia coli trxA/Thioredoxin Nanobody
MBS1568361-01 0.1 mg

Anti-Escherichia coli trxA/Thioredoxin Nanobody

Sign In for Pricing
View Details
Anti-Escherichia coli trxA/Thioredoxin Nanobody
MBS1568361-02 1 mg

Anti-Escherichia coli trxA/Thioredoxin Nanobody

Sign In for Pricing
View Details