Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Iberiotoxin

Iberiotoxin (IbTx) is a toxin that was originally isolated from Buthus tamulus scorpion venom. Iberiotoxin inhibits selectively the high conductance Ca2+-activated K+ channel (KCa1.1) at nanomolar concentrations (IC50 ~2 nM) . This toxin does not affect other types of calcium-dependent or voltage-dependent K+ channels. Iberiotoxin is a valuable tool to study specifically Maxi-K channels.

Product Specifications

CAS Number

129203-60-7

Specifications

Blocker of high conductance Ca2+-activated K+ channel

Target

K channels

Sequence

FTDVDCSVSKECWSVCKDLFGVDRGKCMGKKCRCYQ

Peptide Number

12IBX001

Disulfide Bonds

Cys7-Cys28; Cys13-Cys33; Cys17-Cys35

N Terminal Sequence

PQ

C Terminal Sequence

OH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DBH CRISPR Activation Plasmid (h)
sc-402441-ACT 20 µg

DBH CRISPR Activation Plasmid (h)

Sign In for Pricing
View Details
Human UCP1 (Uncoupling Protein 1, Mitochondrial) ELISA Kit
EK243865 96 Well

Human UCP1 (Uncoupling Protein 1, Mitochondrial) ELISA Kit

Sign In for Pricing
View Details
Cd4 Mouse siRNA Oligo Duplex (Locus ID 12504)
SR414875 1 Kit

Cd4 Mouse siRNA Oligo Duplex (Locus ID 12504)

Sign In for Pricing
View Details
Human FOLR1 / Folate receptor alpha Recombinant Protein
R1599h 1 Each

Human FOLR1 / Folate receptor alpha Recombinant Protein

Sign In for Pricing
View Details
CDCP1 (TRASK, CUB domain-containing protein 1, CD318) discontinued
135973 50 µg

CDCP1 (TRASK, CUB domain-containing protein 1, CD318) discontinued

Sign In for Pricing
View Details
PDsRed1-N1-EIF3E (455-1792nt)
PPL80027-2a 1 Each

PDsRed1-N1-EIF3E (455-1792nt)

Sign In for Pricing
View Details