Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cy5-Huwentoxin-IV

Huwentoxin IV (HwTx-IV) is a neurotoxin that was originally isolated from Haplopelma schmidti (Chinese bird spider) . This lethal neurotoxin acts selectively on tetrodotoxin-sensitive (TTX-S) voltage-gated sodium channels, with an IC50 of 30 nM in rat DRG neurons. It preferentially inhibits neuronal voltage-gated sodium channel subtype hNav1.7 (SCN9A, IC50 is 26 nM), rNav1.2 (SCN2A, IC50 is 150 nM), and rNav1.3 (SCN3A, IC50 is 338 nM), compared with muscle subtypes rNav1.4 (SCN4A) and hNav1.5 (SCN5A) (IC50 is > 10 µM) . Huwentoxin IV inhibits the activation of sodium channels by trapping the voltage sensor of domain II of the site 4 in the inward, closed configuration. Cy5-Huwentoxin IV is a fluorescently tagged version of Huwentoxin IV.

Product Specifications

Specifications

TTX-S selective blocker

Target

Na channels

Sequence

ECLEIFKACNPSNDQCCKSSKLVCSRKTRWCKYQI

Peptide Number

HWF002

Disulfide Bonds

Cys2-Cys17; Cys9-Cys24 ; Cys16-Cys31

N Terminal Sequence

Cy5

C Terminal Sequence

NH2

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

30mL PETG Square Media Bottles, Sterile, Tray-Packed, 40/pk, 280/cs
CS0038-354113 1 Each

30mL PETG Square Media Bottles, Sterile, Tray-Packed, 40/pk, 280/cs

Sign In for Pricing
View Details
Mouse granzyme A CLIA Kit
MBS8426280-01 1 Kit

Mouse granzyme A CLIA Kit

Sign In for Pricing
View Details
Mouse granzyme A CLIA Kit
MBS8426280-02 5x 1 Kit

Mouse granzyme A CLIA Kit

Sign In for Pricing
View Details
SLC35D1 Peptide - middle region (AAP66950)
AAP66950-100UG 100 µg

SLC35D1 Peptide - middle region (AAP66950)

Sign In for Pricing
View Details
Anti-Human CD49e Recombinant Antibody
YR1168-01 1 mg

Anti-Human CD49e Recombinant Antibody

Sign In for Pricing
View Details
Anti-Human CD49e Recombinant Antibody
YR1168-02 5 mg

Anti-Human CD49e Recombinant Antibody

Sign In for Pricing
View Details