Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Huwentoxin-IV

Huwentoxin IV (HwTx-IV) is a neurotoxin that was originally isolated from Haplopelma schmidti (Chinese bird spider) . This lethal neurotoxin acts selectively on tetrodotoxin-sensitive (TTX-S) voltage-gated sodium channels, with an IC50 of 30 nM in rat DRG neurons. It preferentially inhibits neuronal voltage-gated sodium channel subtype hNav1.7 (SCN9A, IC50 is 26 nM), rNav1.2 (SCN2A, IC50 is 150 nM), and rNav1.3 (SCN3A, IC50 is 338 nM), compared with muscle subtypes rNav1.4 (SCN4A) and hNav1.5 (SCN5A) (IC50 is > 10 µM) . Huwentoxin IV inhibits the activation of sodium channels by trapping the voltage sensor of domain II of the site 4 in the inward, closed configuration.

Product Specifications

CAS Number

526224-73-7

Specifications

TTX-S selective blocker

Target

Na channels

Sequence

ECLEIFKACNPSNDQCCKSSKLVCSRKTRWCKYQI

Peptide Number

08HWT002

Disulfide Bonds

Cys2-Cys17; Cys9-Cys24; Cys16-Cys31

N Terminal Sequence

H

C Terminal Sequence

NH2

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Actinin Alpha 3 (ACTN3) Antibody
abx130639-01 100 µL

Actinin Alpha 3 (ACTN3) Antibody

Sign In for Pricing
View Details
Actinin Alpha 3 (ACTN3) Antibody
abx130639-02 200 µL

Actinin Alpha 3 (ACTN3) Antibody

Sign In for Pricing
View Details
Actinin Alpha 3 (ACTN3) Antibody
abx130639-03 1 mL

Actinin Alpha 3 (ACTN3) Antibody

Sign In for Pricing
View Details
AKR1A1 Mouse Monoclonal Antibody [Clone ID: OTI8H2]
TA500743S 30 µL

AKR1A1 Mouse Monoclonal Antibody [Clone ID: OTI8H2]

Sign In for Pricing
View Details
Recombinant Human CD85g/LILRA4/ILT7 Protein, N-His
bs-105191P-01 20 µg

Recombinant Human CD85g/LILRA4/ILT7 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human CD85g/LILRA4/ILT7 Protein, N-His
bs-105191P-02 50 µg

Recombinant Human CD85g/LILRA4/ILT7 Protein, N-His

Sign In for Pricing
View Details