Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Huwentoxin-IV

Huwentoxin IV (HwTx-IV) is a neurotoxin that was originally isolated from Haplopelma schmidti (Chinese bird spider) . This lethal neurotoxin acts selectively on tetrodotoxin-sensitive (TTX-S) voltage-gated sodium channels, with an IC50 of 30 nM in rat DRG neurons. It preferentially inhibits neuronal voltage-gated sodium channel subtype hNav1.7 (SCN9A, IC50 is 26 nM), rNav1.2 (SCN2A, IC50 is 150 nM), and rNav1.3 (SCN3A, IC50 is 338 nM), compared with muscle subtypes rNav1.4 (SCN4A) and hNav1.5 (SCN5A) (IC50 is > 10 µM) . Huwentoxin IV inhibits the activation of sodium channels by trapping the voltage sensor of domain II of the site 4 in the inward, closed configuration.

Product Specifications

CAS Number

526224-73-7

Specifications

TTX-S selective blocker

Target

Na channels

Sequence

ECLEIFKACNPSNDQCCKSSKLVCSRKTRWCKYQI

Peptide Number

08HWT002

Disulfide Bonds

Cys2-Cys17; Cys9-Cys24; Cys16-Cys31

N Terminal Sequence

H

C Terminal Sequence

NH2

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FLRT2 (NM_013231) Human Tagged ORF Clone
RG224270 10 µg

FLRT2 (NM_013231) Human Tagged ORF Clone

Sign In for Pricing
View Details
RNY4P13 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K1865607 1.0 µg DNA

RNY4P13 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Canine Apolipoprotein A-I-binding protein (APOA1BP) ELISA Kit
MBS7249186-01 48 Well

Canine Apolipoprotein A-I-binding protein (APOA1BP) ELISA Kit

Sign In for Pricing
View Details
Canine Apolipoprotein A-I-binding protein (APOA1BP) ELISA Kit
MBS7249186-02 96 Well

Canine Apolipoprotein A-I-binding protein (APOA1BP) ELISA Kit

Sign In for Pricing
View Details
Canine Apolipoprotein A-I-binding protein (APOA1BP) ELISA Kit
MBS7249186-03 5x 96 Well

Canine Apolipoprotein A-I-binding protein (APOA1BP) ELISA Kit

Sign In for Pricing
View Details
Canine Apolipoprotein A-I-binding protein (APOA1BP) ELISA Kit
MBS7249186-04 10x 96 Well

Canine Apolipoprotein A-I-binding protein (APOA1BP) ELISA Kit

Sign In for Pricing
View Details