Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Echistatin α1 isoform

Echistatin was originally purified from the venom of the viper Echis carinatus. Echistatin is a cyclic RGD peptide that inhibits platelet aggregation by inhibiting the glycoprotein IIb/IIIa complex receptor. Echistatin is a potent disintegrin that antagonize αVβ3 integrin and has been described to inhibit cell proliferation, migration, invasion, and adhesion of αVβ3 expressing cells.

Product Specifications

CAS Number

154303-05-6

Specifications

Antagonization of αVβ3 integrin. Inhibition of cell proliferation, migration, invasion, and adhesion of αVβ3 expressing cells.

Target

Integrins

Sequence

ECESGPCCRNCKFLKEGTICKRARGDDMDDYCNGKTCDCPRNPHKGPAT

Peptide Number

ECH001

Disulfide Bonds

Cys2-Cys11; Cys7-Cys32; Cys8-Cys37; Cys20-Cys39

N Terminal Sequence

H

C Terminal Sequence

OH

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Cbr2 shRNA (UAS) - Lentiviral mouse Cbr2 shRNA (UAS) (100)
GTR15208710 1 Vial

Lentiviral mouse Cbr2 shRNA (UAS) - Lentiviral mouse Cbr2 shRNA (UAS) (100)

Sign In for Pricing
View Details
MAPK15 Double Nickase Plasmid (m)
sc-436070-NIC 20 µg

MAPK15 Double Nickase Plasmid (m)

Sign In for Pricing
View Details
MAGEB4 sgRNA CRISPR Lentivector set (Human)
K1255101 3x 1.0 µg

MAGEB4 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
Recombinant Mycobacterium Tuberculosis Rv2248 Protein (aa 1-271)
VAng-Yyj0261-50gEcoli 50 µg (E. coli)

Recombinant Mycobacterium Tuberculosis Rv2248 Protein (aa 1-271)

Sign In for Pricing
View Details
KRG2/DDX11 Rabbit Polyclonal Antibody (Cy5)
orb883297 100 µL

KRG2/DDX11 Rabbit Polyclonal Antibody (Cy5)

Sign In for Pricing
View Details
(R) -5-Chloro-1,2,3,4-tetrahydronaphthalen-1-amine hydrochloride
OR87343-01 100 mg

(R) -5-Chloro-1,2,3,4-tetrahydronaphthalen-1-amine hydrochloride

Sign In for Pricing
View Details