Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dc1a

β-Diguetoxin-Dc1a (Dc1a) is a peptide which has been isolated from the desert bush spider Diguetia canities. Dc1a has demonstrated insecticidal properties by promoting the opening of German cockroach voltage-gated sodium (Nav) channels (BgNav1) without affecting human Nav channels.

Product Specifications

Specifications

Opening of German cockroach voltage-gated sodium (Nav) channels (BgNav1)

Target

Na channels

Sequence

AKDGDVEGPAGCKKYDVECDSGECCQKQYLWYKWRPLDCRCLKSGFFSSKCVCRDV

Peptide Number

DCA001

Disulfide Bonds

Cys12-Cys25; Cys19-Cys39; Cys24-Cys53; Cys41-Cys51

N Terminal Sequence

H

C Terminal Sequence

OH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

pCMV-3×FLAG-SPTB Plasmid
PVT53522 2 µg

pCMV-3×FLAG-SPTB Plasmid

Sign In for Pricing
View Details
Mdfi sgRNA CRISPR Lentivector set (Rat)
K6679601 3x 1.0 µg

Mdfi sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details
Tau (Phospho-Ser396) Antibody
orb14824-01 50 μL

Tau (Phospho-Ser396) Antibody

Sign In for Pricing
View Details
Tau (Phospho-Ser396) Antibody
orb14824-02 100 µL

Tau (Phospho-Ser396) Antibody

Sign In for Pricing
View Details
VAX1 CRISPR All-in-one AAV vector set (with saCas9)(Rat)
49438156 3x 1.0 µg DNA

VAX1 CRISPR All-in-one AAV vector set (with saCas9)(Rat)

Sign In for Pricing
View Details
Valyl-tRNA Synthetase, NT (G7A, Protein G7a, Valine-tRNA ligase, ValRS, VARS1, VARS2) (PE) discontinued
V2017-50A-PE 200 µL

Valyl-tRNA Synthetase, NT (G7A, Protein G7a, Valine-tRNA ligase, ValRS, VARS1, VARS2) (PE) discontinued

Sign In for Pricing
View Details