Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dc1a

β-Diguetoxin-Dc1a (Dc1a) is a peptide which has been isolated from the desert bush spider Diguetia canities. Dc1a has demonstrated insecticidal properties by promoting the opening of German cockroach voltage-gated sodium (Nav) channels (BgNav1) without affecting human Nav channels.

Product Specifications

Specifications

Opening of German cockroach voltage-gated sodium (Nav) channels (BgNav1)

Target

Na channels

Sequence

AKDGDVEGPAGCKKYDVECDSGECCQKQYLWYKWRPLDCRCLKSGFFSSKCVCRDV

Peptide Number

DCA001

Disulfide Bonds

Cys12-Cys25; Cys19-Cys39; Cys24-Cys53; Cys41-Cys51

N Terminal Sequence

H

C Terminal Sequence

OH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Carcinoembryonic Antigen/ CD66 Antibody Clone C66/195, Unconjugated-100ug
1048-MSM2-P1 100ug

Anti-Carcinoembryonic Antigen/ CD66 Antibody Clone C66/195, Unconjugated-100ug

Sign In for Pricing
View Details
Duck Melanocortin-2 Receptor Accessory Protein 2 (MRAP2) ELISA Kit
MBS9914201 Inquire

Duck Melanocortin-2 Receptor Accessory Protein 2 (MRAP2) ELISA Kit

Sign In for Pricing
View Details
MPHOSPH10 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
30351111 3x 1.0 µg

MPHOSPH10 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
IYD Blocking Peptide
MBS9621803-01 1 mg

IYD Blocking Peptide

Sign In for Pricing
View Details
IYD Blocking Peptide
MBS9621803-02 5x 1 mg

IYD Blocking Peptide

Sign In for Pricing
View Details
IL6R Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV702719 1.0 µg DNA

IL6R Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details