Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cy3-Crotamine

Cy3-crotamine is a fluorescent version of Crotamine which is a basic peptide present in the venom of the South American rattlesnake Crotalus durissus terrificus. Multiple biological functions have been attributed to Crotamine. It is a natural cell-penetrating peptide with selective biological action towards actively proliferating cell types such as tumor cells. Moreover, it has been reported that crotamine is a blocker of Kv1.3 (IC50 around 300 nM) as well as Kv1.1 and Kv1.2. It has analgesic properties and myonecrotic effects. In addition, crotamine belongs to the beta-defensin peptides and as such demonstrates antibacterial properties by interacting with lipid membranes.

Product Specifications

Specifications

Blocker of Kv1.3, Kv1.1 and Kv1.2 channels / Cell Penetrating Peptide

Target

Others

Sequence

YKQCHKKGGHCFPKEKICLPPSSDFGKMDCRWRWKCCKKGSG

Peptide Number

CRO002

Disulfide Bonds

Cys4-Cys36; Cys11-Cys30; Cys18-Cys37

N Terminal Sequence

Cy3

C Terminal Sequence

OH

More Discoveries

Explore Other Products

Browse additional items from our catalog

BBX AAV Vector (Rat) (CMV)
13043106 1 µg

BBX AAV Vector (Rat) (CMV)

Sign In for Pricing
View Details
SCP-1 HDR Plasmid (m2)
sc-423231-HDR-2 20 µg

SCP-1 HDR Plasmid (m2)

Sign In for Pricing
View Details
Recombinant Schizosaccharomyces pombe Serine/threonine-protein kinase psk1 (psk1)
MBS1481735-01 0.02 mg (E-Coli)

Recombinant Schizosaccharomyces pombe Serine/threonine-protein kinase psk1 (psk1)

Sign In for Pricing
View Details
Recombinant Schizosaccharomyces pombe Serine/threonine-protein kinase psk1 (psk1)
MBS1481735-02 0.02 mg (Yeast)

Recombinant Schizosaccharomyces pombe Serine/threonine-protein kinase psk1 (psk1)

Sign In for Pricing
View Details
Recombinant Schizosaccharomyces pombe Serine/threonine-protein kinase psk1 (psk1)
MBS1481735-03 0.1 mg (E-Coli)

Recombinant Schizosaccharomyces pombe Serine/threonine-protein kinase psk1 (psk1)

Sign In for Pricing
View Details
Recombinant Schizosaccharomyces pombe Serine/threonine-protein kinase psk1 (psk1)
MBS1481735-04 0.1 mg (Yeast)

Recombinant Schizosaccharomyces pombe Serine/threonine-protein kinase psk1 (psk1)

Sign In for Pricing
View Details