Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Crotamine

Crotamine is a basic peptide present in the venom of the South American rattlesnake Crotalus durissus terrificus. Multiple biological functions have been attributed to Crotamine. It is a natural cell-penetrating peptide with selective biological action towards actively proliferating cell types. Moreover, it has been reported that crotamine is a blocker of Kv1.3 (IC50 around 300 nM) as well as Kv1.1 and Kv1.2. It has analgesic properties and myonecrotic effects. In addition, crotamine belongs to the beta-defensin peptides and as such demonstrates antibacterial properties by interacting with lipid membranes.

Product Specifications

Specifications

Blocker of Kv1.3, Kv1.1 and Kv1.2 channels / Cell Penetrating Peptide

Target

Others

Sequence

YKQCHKKGGHCFPKEKICLPPSSDFGKMDCRWRWKCCKKGSG

Peptide Number

CRO001

Disulfide Bonds

Cys4-Cys36; Cys11-Cys30; Cys18-Cys37

N Terminal Sequence

H

C Terminal Sequence

OH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-AF10 Rabbit pAb
GB112809-50 50 μL

Anti-AF10 Rabbit pAb

Sign In for Pricing
View Details
FABP5L11 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
57259111 3x 1.0 µg

FABP5L11 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
THOC1 sgRNA CRISPR Lentivector (Human) (Target 3)
K2370004 1.0 µg DNA

THOC1 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Phospho-ROCK2 (Thr249) Polyclonal Antibody, APC-Cy7 Conjugated
bs-5675R-APC-Cy7 100 µL

Phospho-ROCK2 (Thr249) Polyclonal Antibody, APC-Cy7 Conjugated

Sign In for Pricing
View Details
AdmiRa-rno-mir-3545 Virus
mr0217 250 µL

AdmiRa-rno-mir-3545 Virus

Sign In for Pricing
View Details
iASPP (PPP1R13L) (NM_006663) Human Untagged Clone
SC115944 10 µg

iASPP (PPP1R13L) (NM_006663) Human Untagged Clone

Sign In for Pricing
View Details