Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Crotamine

Crotamine is a basic peptide present in the venom of the South American rattlesnake Crotalus durissus terrificus. Multiple biological functions have been attributed to Crotamine. It is a natural cell-penetrating peptide with selective biological action towards actively proliferating cell types. Moreover, it has been reported that crotamine is a blocker of Kv1.3 (IC50 around 300 nM) as well as Kv1.1 and Kv1.2. It has analgesic properties and myonecrotic effects. In addition, crotamine belongs to the beta-defensin peptides and as such demonstrates antibacterial properties by interacting with lipid membranes.

Product Specifications

Specifications

Blocker of Kv1.3, Kv1.1 and Kv1.2 channels / Cell Penetrating Peptide

Target

Others

Sequence

YKQCHKKGGHCFPKEKICLPPSSDFGKMDCRWRWKCCKKGSG

Peptide Number

CRO001

Disulfide Bonds

Cys4-Cys36; Cys11-Cys30; Cys18-Cys37

N Terminal Sequence

H

C Terminal Sequence

OH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(2R,3S,4E,8Z) -2- ((tert-Butoxycarbonyl) amino) -3-hydroxyoctadeca-4,8-dien-1-yl Pivalate
421707-01 2.5 mg

(2R,3S,4E,8Z) -2- ((tert-Butoxycarbonyl) amino) -3-hydroxyoctadeca-4,8-dien-1-yl Pivalate

Sign In for Pricing
View Details
(2R,3S,4E,8Z) -2- ((tert-Butoxycarbonyl) amino) -3-hydroxyoctadeca-4,8-dien-1-yl Pivalate
421707-02 5 mg

(2R,3S,4E,8Z) -2- ((tert-Butoxycarbonyl) amino) -3-hydroxyoctadeca-4,8-dien-1-yl Pivalate

Sign In for Pricing
View Details
Human Bradykinin (BK) High-sensitive ELISA Kit
EKN51383 96 Tests

Human Bradykinin (BK) High-sensitive ELISA Kit

Sign In for Pricing
View Details
Recombinant Human ALOX5AP/FLAP Protein (His Tag)
PKSH031059 100 µg

Recombinant Human ALOX5AP/FLAP Protein (His Tag)

Sign In for Pricing
View Details
IL10RB Monoclonal Antibody
BT-MCA4112-01 50 µL

IL10RB Monoclonal Antibody

Sign In for Pricing
View Details
IL10RB Monoclonal Antibody
BT-MCA4112-02 100 µL

IL10RB Monoclonal Antibody

Sign In for Pricing
View Details