Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Crotamine

Crotamine is a basic peptide present in the venom of the South American rattlesnake Crotalus durissus terrificus. Multiple biological functions have been attributed to Crotamine. It is a natural cell-penetrating peptide with selective biological action towards actively proliferating cell types. Moreover, it has been reported that crotamine is a blocker of Kv1.3 (IC50 around 300 nM) as well as Kv1.1 and Kv1.2. It has analgesic properties and myonecrotic effects. In addition, crotamine belongs to the beta-defensin peptides and as such demonstrates antibacterial properties by interacting with lipid membranes.

Product Specifications

Specifications

Blocker of Kv1.3, Kv1.1 and Kv1.2 channels / Cell Penetrating Peptide

Target

Others

Sequence

YKQCHKKGGHCFPKEKICLPPSSDFGKMDCRWRWKCCKKGSG

Peptide Number

CRO001

Disulfide Bonds

Cys4-Cys36; Cys11-Cys30; Cys18-Cys37

N Terminal Sequence

H

C Terminal Sequence

OH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD1A Antibody
orb2312030-01 20 µg

CD1A Antibody

Sign In for Pricing
View Details
CD1A Antibody
orb2312030-02 100 µg

CD1A Antibody

Sign In for Pricing
View Details
CD1A Antibody
orb2312030-03 100 ug (without BSA and Azide)

CD1A Antibody

Sign In for Pricing
View Details
MYO1G Protein Vector (Mouse) (pPM-C-His)
PV203617 500 ng

MYO1G Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
RN5S231 Adenovirus (Human)
39798051 1.0 mL

RN5S231 Adenovirus (Human)

Sign In for Pricing
View Details
Mmu-miR-6386 miRNA Mimic
orb1874969-01 5 nmol

Mmu-miR-6386 miRNA Mimic

Sign In for Pricing
View Details