Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Exendin 4

Exendin-4 is a 39-amino acid peptide incretin mimetic. Exendin-4, also known as Exenatide, was originally isolated from the venom of Gila monster lizard called Heloderma suspectum1. Exendin-4 is a long-acting analog of the mammalian intestinal hormone glucagon-like peptide I (GLP-1) and therefore exhibits glucoregulatory activities to control plasma glucose levels2. Exendin-4 enhances insulin synthesis and secretion in a glucose-dependent manner, while downregulating inappropriately high glucagon release, slowing gastric emptying and decreasing appetite2. The increase in maximum insulin secretion is due to a greater increase in cAMP production in pancreatic β cells3. Exendin-4 is a potent agonist of the Glucagon-Like Peptide-1 Receptor (GLP-1R ; Kd = 136pM) . It has been reported that exendin-4 is a more potent insulinotropic agent when given intravenously to rats than is glucagon-like peptide-1 (GLP-1) as indicated by the lower ED50 (ED50 0.19 nmol/kg for glucagon-like peptide-1 versus 0.0143 nmol/kg for exendin-4) 3. Subcutaneous administration of exendin-4 at doses of 5µg and 10 µg twice daily attenuates glycemia in patients with type 2 diabetes, who are treated with metformin, an antidiabetic drug and not achieving adequate glycemic control4. In these patients, exendin-4 was tolerated and triggered a reduction in glycated hemoglobin (HbA1C ≤ 7%), with no weight gain and no increased incidence of hypoglycemia4. Long-term treatment with exendin-4 has a beneficial effect on the pancreatic β-cell function by stimulating both the neogeneration and the proliferation of β-cells when administered to rats2. Furthermore, exendin-4 has shown anti-atherosclerogenetic properties5 as well as the ability to reduce hepatic steatosis in obese ob/ob mice by improving insulin sensitivity

Product Specifications

CAS Number

141758-74-9

Sequence

HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2

Peptide Number

SB029

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FABP5 Rabbit pAb
E45R26467N 50 ul

FABP5 Rabbit pAb

Sign In for Pricing
View Details
Cx3cl1 (NM_009142) Mouse Tagged ORF Clone Lentiviral Particle
MR206171L3V 200 µL

Cx3cl1 (NM_009142) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Mouse Solute carrier family 22 member 2, Slc22a2 ELISA KIT
ELI-20100m 96 Tests

Mouse Solute carrier family 22 member 2, Slc22a2 ELISA KIT

Sign In for Pricing
View Details
MMP12 Rabbit Polyclonal Antibody
orb1741996 100 µL

MMP12 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Synaptotagmin II Lentiviral Activation Particles (m)
sc-423244-LAC 200 µL

Synaptotagmin II Lentiviral Activation Particles (m)

Sign In for Pricing
View Details
OSI-296
T28271-01 25 mg

OSI-296

Sign In for Pricing
View Details