Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cathelicidin antimicrobial peptide 18

LL-37, also known as CAP-18 for Cathelicidin antimicrobial peptide 18, is a 37 amino acid cationic peptide. LL-37 is also a typical linear antimicrobial peptide which can eliminate a wide range of pathogenes, including bacteria, viruses, fungi, and parasites. LL-37 is the only human cathelicidin peptide reported yet, found in lysosomes of macrophages and leukocytes. LL-37 plays an important role in the first act of defense against local infection and systemic invasion of pathogens at sites of inflammation. LL-37 shows cytotoxicity against bacterial and normal eukaryotic cells and is significantly resistant to proteolytic degradation. Besides its antimicrobial functions, LL-37 also has immunomodulatory roles. LL-37 suppresses the production of pro-inflammatory cytokines, TNF-α and IL-6 in infected monocytes. LL-37 increases cytokine and chemokine liberation from local cells and leucocytes and has chemotactic effects on a large number of immune cells.

Product Specifications

CAS Number

154947-66-7

Product Name Alternative

CAP18, LL-37

Sequence

[LL-37, 37 aa]

Peptide Number

SB004

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Dram2 shRNA (UAS) - Lentiviral mouse Dram2 shRNA (UAS) plasmid
GTR15190903 1 Vial

Lentiviral mouse Dram2 shRNA (UAS) - Lentiviral mouse Dram2 shRNA (UAS) plasmid

Sign In for Pricing
View Details
Mirtazapine N-oxide
IM26015-01 2 mg

Mirtazapine N-oxide

Sign In for Pricing
View Details
Mirtazapine N-oxide
IM26015-02 5 mg

Mirtazapine N-oxide

Sign In for Pricing
View Details
Mirtazapine N-oxide
IM26015-03 10 mg

Mirtazapine N-oxide

Sign In for Pricing
View Details
Mirtazapine N-oxide
IM26015-04 25 mg

Mirtazapine N-oxide

Sign In for Pricing
View Details
Human PAX1 mRNA
HY-174562 500 µg

Human PAX1 mRNA

Sign In for Pricing
View Details