Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Beta-Defensin 3 peptide

Mouse Beta-Defensin 3 peptide (mBD3), a homolog of human beta-defensin 2 (hBD2), is a cysteine-rich cationic antimicrobial peptide of 41 amino acids which belongs to the defensins family. Defensin peptides are cationic peptides originally produced in various organs. They are involved in the protection against different kinds of pathogens like bacteria, fungi, and several viruses and play an important role in inflammation and wound repair. mBD3 peptide showed antimicrobial activity against Gram-negative bacteria S.Aureus and S.pyogenes and against Gram-positive bacteria like certain strains of P.Aeruginosa (MIC of 8 µg/mL) and E.coli (MIC of 16 µg/mL) . Antimicrobial activity has also been demonstrated against C.Albicans. The in vivo and in vitro efficiency of mBD3 against viruses like influenza was also shown. mBD3 can be interesting for therapeutic use.

Product Specifications

Product Name Alternative

MBD3

Sequence

KKINNPVSCLRKGGRCWNRCIGNTRQIGSCGVPFLKCCKRK

Peptide Number

SB003

Disulfide Bonds

Cys8-Cys37, Cys15-Cys30, Cys20-Cys38

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

[ (1,1-dioxidotetrahydrothien-3-yl) thio]acetic acid
sc-339176 1 g

[ (1,1-dioxidotetrahydrothien-3-yl) thio]acetic acid

Sign In for Pricing
View Details
Sulphuric Acid 0.05 mol/L (N/10) (0.1N) for 500 ml solution
2606K 01AMP 1 Amp

Sulphuric Acid 0.05 mol/L (N/10) (0.1N) for 500 ml solution

Sign In for Pricing
View Details
Recombinant Legionella Pneumophila rpsK Protein (aa 1-132) (strain Lens)
VAng-Lsx04201-50gEcoli 50 µg (E. coli)

Recombinant Legionella Pneumophila rpsK Protein (aa 1-132) (strain Lens)

Sign In for Pricing
View Details
AKAP7 (NM_138633) Human Recombinant Protein
TP323812 20 µg

AKAP7 (NM_138633) Human Recombinant Protein

Sign In for Pricing
View Details
CD4 Antibody
orb1536100 50 μL

CD4 Antibody

Sign In for Pricing
View Details
Mouse Acp5 ELISA Kit
EF012805 96 Tests

Mouse Acp5 ELISA Kit

Sign In for Pricing
View Details