Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human beta-defensin-2 peptide

Human beta-defensin-2 (hBD-2), also known as skin-antimicrobial peptide 1 (SAP1) is a cysteine-rich cationic antimicrobial peptide of 41 amino acids. It was originally isolated from skin cells of psoriasis patients. hBD-2, which belongs to the defensin family, is implicated in the innate immunity thanks to its antimicrobial activity. Thus, β-defensins can play a role at the cutaneous level by limiting the use of antibiotics in severe burns and disease like psoriasis. Moreover, at the pulmonary level, defensins might be involved in the resorption of the infection in cases of cystic fibrosis. hBD-2 is produced after stimulation of epithelial cells following their contact with some organisms like Gram-negative bacteria and Candida Albicans, fungus or cytokines such as TNF-alpha and IL-1 beta. This antimicrobial activity was shown to be microbicidal at concentrations greater than 1 µM and was lethal for E.Coli and pseudomonas (LD90 : 10 mg/mL) and Candida Albicans (LD90 : 25 mg/mL) . Besides its antimicrobial activity, hBD-2 also exhibits proinflammatory properties as chemoattractants for memory T-cells, immature dendritic cells, mast cells and neutrophils. hBD-2 has also demonstrated inhibitory activity of the voltage-gated potassium channel Kv1.3 at picomolar concentration. Kv1.3 are overexpressed by T-cells in case of autoimmune disorders.

Product Specifications

Product Name Alternative

HBD-2

Sequence

GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP

Peptide Number

SB002

Disulfide Bonds

Cys8-Cys37, Cys15-Cys30, Cys20-Cys38

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ID2 antibody
10R-4415 100 µL

ID2 antibody

Sign In for Pricing
View Details
pCMV-EGFP-NBN-Neo Plasmid
PVT54947 2 µg

pCMV-EGFP-NBN-Neo Plasmid

Sign In for Pricing
View Details
DIAPH2 Polyclonal Antibody, AbBy Fluor™ 350 Conjugated
bs-13002R-BF350-TR 20 µL

DIAPH2 Polyclonal Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing
View Details
9 (E),11 (E) -Conjugated Linoleic Acid methyl ester
orb2283089-01 50 mg

9 (E),11 (E) -Conjugated Linoleic Acid methyl ester

Sign In for Pricing
View Details
9 (E),11 (E) -Conjugated Linoleic Acid methyl ester
orb2283089-02 10 mg

9 (E),11 (E) -Conjugated Linoleic Acid methyl ester

Sign In for Pricing
View Details
BMP15 Rabbit mAb Antibody
orb1727103-01 50 µL

BMP15 Rabbit mAb Antibody

Sign In for Pricing
View Details