Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SARS-CoV-2 Spike RBD 395-430 peptide

SARS-CoV-2 Spike RBD 395-430 peptide is an epitope of interest of the SARS-CoV-2 Spike S glycoprotein Receptor-Binding Domain (RBD) . SARS-CoV-2 Spike RBD 395-430 peptide is useful for vaccine development and for structure-activity relationship studies SARS-CoV-2 Spike (S) glycoprotein Spike (S) glycoprotein corresponds to one of the leading targets for COVID-19 disease. Present on the surface of Sars-CoV-2 virus, Spike S protein is a class I fusion protein that allows the virus to enter host cells. With a 1 273 aa length, Spike protein has 2 subunits : S1 contains the receptor-binding domain RBD and S2 induces the fusion of the viral envelop with the cellular membrane. SARS-CoV-2 Spike RBD: The receptor-binding domain in SARS-CoV-2 Spike protein allows binding to the Angiotensin-Converting Enzyme receptor 2 (ACE2 receptor) which mediates the viral entry. SB-PEPTIDE also offers SARS-CoV-2 Spike RBD 395-430 (Biotin-LC) peptide

Product Specifications

Sequence

VYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFT

Peptide Number

SB091

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PTEN Antibody
E18-6351-1 50 µg - 50 µL

PTEN Antibody

Sign In for Pricing
View Details
Anti-eRF1/ETF1 Antibody Picoband® (monoclonal, 3E5), Dylight594 Conjugate
M04157-1-Dylight594 100 µg

Anti-eRF1/ETF1 Antibody Picoband® (monoclonal, 3E5), Dylight594 Conjugate

Sign In for Pricing
View Details
MED14-AS1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV732685 1.0 µg DNA

MED14-AS1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
2-Chloro-5-methylpyridine-4-carboxylic acid
BNB03056-01 1 g

2-Chloro-5-methylpyridine-4-carboxylic acid

Sign In for Pricing
View Details
2-Chloro-5-methylpyridine-4-carboxylic acid
BNB03056-02 10 g

2-Chloro-5-methylpyridine-4-carboxylic acid

Sign In for Pricing
View Details
Nat8l (NM_001001985) Mouse Tagged Lenti ORF Clone
MR221053L3 10 µg

Nat8l (NM_001001985) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details