Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cecropin A

Cecropin A is an antimicrobial peptide active against Gram-positive and Gram-negative bacteria. Some studies have suggested that cecropin A binds to negatively charged membrane lipids and form a packed layer which permeabilize the membranes and help to kill bacteria. It was shown that cecropin A presents a LC50 of 0.9 µM and a LC90 of 1.7 µM against certain E.Coli strains. Besides its well-known antimicrobial properties, studies have demonstrated tumoricidal activity of cecropin A against leukemia, lymphoma, colon carcinoma cell lines and other tumour cell lines. Furthermore, Cecropin A has a fungicidal activity. A study has shown that cecropin A reaches a complete lethality at approximately 25 mM for germinating conidia of Aspergillus spp. and a complete lethality for nongerminated and germinated conidia of Fusarium spp. at 1.5 mM.

Product Specifications

CAS Number

80451-04-3

Sequence

KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK-NH2

Peptide Number

SB009

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine Actin binding LIM protein 1 ELISA Kit
MBS7226995-01 48 Well

Bovine Actin binding LIM protein 1 ELISA Kit

Sign In for Pricing
View Details
Bovine Actin binding LIM protein 1 ELISA Kit
MBS7226995-02 96 Well

Bovine Actin binding LIM protein 1 ELISA Kit

Sign In for Pricing
View Details
Bovine Actin binding LIM protein 1 ELISA Kit
MBS7226995-03 5x 96 Well

Bovine Actin binding LIM protein 1 ELISA Kit

Sign In for Pricing
View Details
Bovine Actin binding LIM protein 1 ELISA Kit
MBS7226995-04 10x 96 Well

Bovine Actin binding LIM protein 1 ELISA Kit

Sign In for Pricing
View Details
SLC25A23 CRISPR/Cas9 KO Plasmid (m)
sc-426300 20 µg

SLC25A23 CRISPR/Cas9 KO Plasmid (m)

Sign In for Pricing
View Details
Recombinant Complement Component 3 (C3)
MBS2012297-01 0.01 mg

Recombinant Complement Component 3 (C3)

Sign In for Pricing
View Details