Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cathelicidin antimicrobial peptide 18

LL-37, also known as CAP-18 for Cathelicidin antimicrobial peptide 18, is a 37 amino acid cationic peptide. LL-37 is also a typical linear antimicrobial peptide which can eliminate a wide range of pathogenes, including bacteria, viruses, fungi, and parasites. LL-37 is the only human cathelicidin peptide reported yet, found in lysosomes of macrophages and leukocytes. LL-37 plays an important role in the first act of defense against local infection and systemic invasion of pathogens at sites of inflammation. LL-37 shows cytotoxicity against bacterial and normal eukaryotic cells and is significantly resistant to proteolytic degradation. Besides its antimicrobial functions, LL-37 also has immunomodulatory roles. LL-37 suppresses the production of pro-inflammatory cytokines, TNF-α and IL-6 in infected monocytes. LL-37 increases cytokine and chemokine liberation from local cells and leucocytes and has chemotactic effects on a large number of immune cells.

Product Specifications

CAS Number

154947-66-7

Product Name Alternative

CAP18, LL-37

Sequence

[LL-37, 37 aa]

Peptide Number

SB004

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATF-2 (phospho Ser112) Polyclonal Antibody
ABP50266-01 30 µL

ATF-2 (phospho Ser112) Polyclonal Antibody

Sign In for Pricing
View Details
ATF-2 (phospho Ser112) Polyclonal Antibody
ABP50266-02 100 µL

ATF-2 (phospho Ser112) Polyclonal Antibody

Sign In for Pricing
View Details
ATF-2 (phospho Ser112) Polyclonal Antibody
ABP50266-03 200 µL

ATF-2 (phospho Ser112) Polyclonal Antibody

Sign In for Pricing
View Details
Conjugated RelB Rabbit mAb
C59028 100 µL

Conjugated RelB Rabbit mAb

Sign In for Pricing
View Details
Beta Arrestin 1 (ARRB1) Mouse Monoclonal Antibody [Clone:2B3]
E45M20779 100 µg

Beta Arrestin 1 (ARRB1) Mouse Monoclonal Antibody [Clone:2B3]

Sign In for Pricing
View Details
PYY3 AAV Vector (Human) (CMV)
38260101 1 µg

PYY3 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details