Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cycloviolacin O2

Cyclotide Cycloviolacin O2 peptide (CyO2) is a cyclotide isolated from Viola odorata. Cyclotides are circular peptides with remarkable characteristics including a head-to-tail cyclized backbone and 6 cysteine residues forming cyclic-cystine-knot motif (CCK) by three disulfide bonds. Cyclotides show potent cytotoxic activity that’s why they represent novel range of cytotoxic agents. Cycloviolacin O2 peptide Cycloviolacin O2 has antitumor effect and specific membrane-disrupting activity resulting in cell death and appears to be selective to tumoral cells. CyO2 has also demonstrated a potent bactericidal activity against Gram – bacteria with a MIC of 2.2µM on E. coli. Cycloviolacin O2 provides a potential scaffold for future drug design. Cycloviolacin O2 peptide is a head-to-tail cyclic peptide with three disulfide bridges between 1-4,2-5 and 3-6. SB-PEPTIDE is able to produce other cyclotides, including modified cyclotides with heavy isotope amino acids, biotin… Contact us to discuss about your project.

Product Specifications

Sequence

GIPCGESCVWIPCISSAIGCSCKSKVCYRN

Peptide Number

SB111

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Trichosanthes kirilowii Ribosome-inactivating protein alpha-trichosanthin
RPC28256-01 20 µg

Recombinant Trichosanthes kirilowii Ribosome-inactivating protein alpha-trichosanthin

Sign In for Pricing
View Details
Recombinant Trichosanthes kirilowii Ribosome-inactivating protein alpha-trichosanthin
RPC28256-02 100 µg

Recombinant Trichosanthes kirilowii Ribosome-inactivating protein alpha-trichosanthin

Sign In for Pricing
View Details
Recombinant Trichosanthes kirilowii Ribosome-inactivating protein alpha-trichosanthin
RPC28256-03 1 mg

Recombinant Trichosanthes kirilowii Ribosome-inactivating protein alpha-trichosanthin

Sign In for Pricing
View Details
CD4 Mouse Monoclonal Antibody [Clone ID: LBI3E11]
AMM15361VCF 100 µg

CD4 Mouse Monoclonal Antibody [Clone ID: LBI3E11]

Sign In for Pricing
View Details
Mouse Solute Carrier Family 22 Member 2 (SLC22A2) ELISA Kit
abx544158 96 Tests

Mouse Solute Carrier Family 22 Member 2 (SLC22A2) ELISA Kit

Sign In for Pricing
View Details
Vorinostat
V7990-01 25 mg

Vorinostat

Sign In for Pricing
View Details