Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SARS-CoV-2 Spike RBD 395-430 peptide

SARS-CoV-2 Spike RBD 395-430 peptide is an epitope of interest of the SARS-CoV-2 Spike S glycoprotein Receptor-Binding Domain (RBD) . SARS-CoV-2 Spike RBD 395-430 peptide is useful for vaccine development and for structure-activity relationship studies SARS-CoV-2 Spike (S) glycoprotein Spike (S) glycoprotein corresponds to one of the leading targets for COVID-19 disease. Present on the surface of Sars-CoV-2 virus, Spike S protein is a class I fusion protein that allows the virus to enter host cells. With a 1 273 aa length, Spike protein has 2 subunits : S1 contains the receptor-binding domain RBD and S2 induces the fusion of the viral envelop with the cellular membrane. SARS-CoV-2 Spike RBD: The receptor-binding domain in SARS-CoV-2 Spike protein allows binding to the Angiotensin-Converting Enzyme receptor 2 (ACE2 receptor) which mediates the viral entry. SB-PEPTIDE also offers SARS-CoV-2 Spike RBD 395-430 (Biotin-LC) peptide

Product Specifications

Sequence

VYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFT

Peptide Number

SB091

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

L-Alanine 4-nitroanilide hydrochloride
BIA4005-01 1 g

L-Alanine 4-nitroanilide hydrochloride

Sign In for Pricing
View Details
L-Alanine 4-nitroanilide hydrochloride
BIA4005-02 5 g

L-Alanine 4-nitroanilide hydrochloride

Sign In for Pricing
View Details
MDM2 ligand 4
orb2945297-01 50 mg

MDM2 ligand 4

Sign In for Pricing
View Details
MDM2 ligand 4
orb2945297-02 10 mg

MDM2 ligand 4

Sign In for Pricing
View Details
Fc gamma RIIA/CD32a, Human (H167R, HEK293, His-Avi)
HY-P75645 1 Each

Fc gamma RIIA/CD32a, Human (H167R, HEK293, His-Avi)

Sign In for Pricing
View Details
Rabbit Polyclonal SIDT2 Antibody [DyLight 488]
NBP2-82009G 0.1 mL

Rabbit Polyclonal SIDT2 Antibody [DyLight 488]

Sign In for Pricing
View Details