Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cecropin A

Cecropin A is an antimicrobial peptide active against Gram-positive and Gram-negative bacteria. Some studies have suggested that cecropin A binds to negatively charged membrane lipids and form a packed layer which permeabilize the membranes and help to kill bacteria. It was shown that cecropin A presents a LC50 of 0.9 µM and a LC90 of 1.7 µM against certain E.Coli strains. Besides its well-known antimicrobial properties, studies have demonstrated tumoricidal activity of cecropin A against leukemia, lymphoma, colon carcinoma cell lines and other tumour cell lines. Furthermore, Cecropin A has a fungicidal activity. A study has shown that cecropin A reaches a complete lethality at approximately 25 mM for germinating conidia of Aspergillus spp. and a complete lethality for nongerminated and germinated conidia of Fusarium spp. at 1.5 mM.

Product Specifications

CAS Number

80451-04-3

Sequence

KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK-NH2

Peptide Number

SB009

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human SRRM1 ELISA KIT
EF003245 96 Tests

Human SRRM1 ELISA KIT

Sign In for Pricing
View Details
Recombinant Mouse Follistatin-like 1/Fstl1 Protein, His Tag
MOP2160 50 µg

Recombinant Mouse Follistatin-like 1/Fstl1 Protein, His Tag

Sign In for Pricing
View Details
Boc- (2S,5R) -5-phenylpyrrolidine-2-carboxylic acid
266596-01 250 mg

Boc- (2S,5R) -5-phenylpyrrolidine-2-carboxylic acid

Sign In for Pricing
View Details
Boc- (2S,5R) -5-phenylpyrrolidine-2-carboxylic acid
266596-02 500 mg

Boc- (2S,5R) -5-phenylpyrrolidine-2-carboxylic acid

Sign In for Pricing
View Details
Boc- (2S,5R) -5-phenylpyrrolidine-2-carboxylic acid
266596-03 1 g

Boc- (2S,5R) -5-phenylpyrrolidine-2-carboxylic acid

Sign In for Pricing
View Details
Boc- (2S,5R) -5-phenylpyrrolidine-2-carboxylic acid
266596-04 2 g

Boc- (2S,5R) -5-phenylpyrrolidine-2-carboxylic acid

Sign In for Pricing
View Details