Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cathelicidin antimicrobial peptide 18

LL-37, also known as CAP-18 for Cathelicidin antimicrobial peptide 18, is a 37 amino acid cationic peptide. LL-37 is also a typical linear antimicrobial peptide which can eliminate a wide range of pathogenes, including bacteria, viruses, fungi, and parasites. LL-37 is the only human cathelicidin peptide reported yet, found in lysosomes of macrophages and leukocytes. LL-37 plays an important role in the first act of defense against local infection and systemic invasion of pathogens at sites of inflammation. LL-37 shows cytotoxicity against bacterial and normal eukaryotic cells and is significantly resistant to proteolytic degradation. Besides its antimicrobial functions, LL-37 also has immunomodulatory roles. LL-37 suppresses the production of pro-inflammatory cytokines, TNF-α and IL-6 in infected monocytes. LL-37 increases cytokine and chemokine liberation from local cells and leucocytes and has chemotactic effects on a large number of immune cells.

Product Specifications

CAS Number

154947-66-7

Product Name Alternative

CAP18, LL-37

Sequence

[LL-37, 37 aa]

Peptide Number

SB004

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRPM4 antibody
MBS832409-01 0.1 mL

TRPM4 antibody

Sign In for Pricing
View Details
TRPM4 antibody
MBS832409-02 5x 0.1 mL

TRPM4 antibody

Sign In for Pricing
View Details
Mouse DnaJ/HSP40Subfamily C,Member 12, DNAJC12 GENLISA ELISA
KLM0876 96 Well

Mouse DnaJ/HSP40Subfamily C,Member 12, DNAJC12 GENLISA ELISA

Sign In for Pricing
View Details
PIK3AP1 Polyclonal Antibody, Biotin Conjugated
bs-13675R-Biotin 100 µL

PIK3AP1 Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details
KHNYN sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K2777006 1.0 µg DNA

KHNYN sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Recombinant Human Macrophage-stimulating protein receptor (MST1R) , partial
MBS949973 Inquire

Recombinant Human Macrophage-stimulating protein receptor (MST1R) , partial

Sign In for Pricing
View Details