Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Beta-Defensin 3 peptide

Mouse Beta-Defensin 3 peptide (mBD3), a homolog of human beta-defensin 2 (hBD2), is a cysteine-rich cationic antimicrobial peptide of 41 amino acids which belongs to the defensins family. Defensin peptides are cationic peptides originally produced in various organs. They are involved in the protection against different kinds of pathogens like bacteria, fungi, and several viruses and play an important role in inflammation and wound repair. mBD3 peptide showed antimicrobial activity against Gram-negative bacteria S.Aureus and S.pyogenes and against Gram-positive bacteria like certain strains of P.Aeruginosa (MIC of 8 µg/mL) and E.coli (MIC of 16 µg/mL) . Antimicrobial activity has also been demonstrated against C.Albicans. The in vivo and in vitro efficiency of mBD3 against viruses like influenza was also shown. mBD3 can be interesting for therapeutic use.

Product Specifications

Product Name Alternative

MBD3

Sequence

KKINNPVSCLRKGGRCWNRCIGNTRQIGSCGVPFLKCCKRK

Peptide Number

SB003

Disulfide Bonds

Cys8-Cys37, Cys15-Cys30, Cys20-Cys38

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LOC100360413 antibody - middle region (ARP48165_P050)
ARP48165_P050 100 µL

LOC100360413 antibody - middle region (ARP48165_P050)

Sign In for Pricing
View Details
Beaker, 2000mL, PP
601809 4/CS

Beaker, 2000mL, PP

Sign In for Pricing
View Details
Recombinant Kocuria rhizophila DNA-directed RNA polymerase subunit beta'(rpoC), partial
MBS1056766 Inquire

Recombinant Kocuria rhizophila DNA-directed RNA polymerase subunit beta'(rpoC), partial

Sign In for Pricing
View Details
Human ATP6V1D (NM_015994) AAV Particle
RC204685A1V 250 µL

Human ATP6V1D (NM_015994) AAV Particle

Sign In for Pricing
View Details
JC-1
BISN0055 5 mg

JC-1

Sign In for Pricing
View Details
Hspa1b 3'UTR GFP Stable Cell Line
TU256007 1.0 mL

Hspa1b 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details