HABP1/C1QBP, Human (His)
HABP1/C1QBP Protein, Human (His) is a recombinant human HABP1 (hyaluronan-binding protein 1) /C1QBP (complement component 1, q subcomponent binding protein) produced in HEK293 cells, with His tag. HABP1/C1QBP is a ubiquitously present glycoprotein having specific affinity towards hyaluronan (HA) [1].
Product Specifications
Product Name Alternative
HABP1/C1QBP Protein, Human (His), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/habp1-c1qbp-protein-human-his.html
Purity
99.90
Smiles
LHTDGDKAFVDFLSDEIKEERKIQKHKTLPKMSGGWELELNGTEAKLVRKVAGEKITVTFNINNSIPPTFDGEEEPSQGQKVEEQEPELTSTPNFVVEVIKNDDGKKALVLDCHYPEDEVGQEDEAESDIFSIREVSFQSTGESEWKDTNYTLNTDSLDWALYDHLMDFLADRGVDNTFADELVELSTALEHQEYITFLEDLKSFVKSQHHHHHH
Molecular Formula
708 (Gene_ID) Q07021 (L74-Q282) (Accession)
Molecular Weight
Approximately 35 kDa
References & Citations
[1]Paramita Saha, et al. Multi-functional, multicompartmental hyaluronan-binding protein 1 (HABP1/p32/gC1qR) : implication in cancer progression and metastasis. Oncotarget. 2018 Feb 13; 9 (12) : 10784–10807.
Shipping Conditions
Dry ice
Storage Conditions
Stored at -80°C for 1 year
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
126526-PE 100 µL
EYS (Protein Eyes Shut Homolog, Epidermal Growth Factor-like Protein 10, EGF-like Protein 10, Epidermal Growth Factor-like Protein 11, EGF-like Protein 11, Protein Spacemaker Homolog, C6orf178, C6orf179, C6orf180, EGFL10, EGFL11, SPAM, UNQ9424/PRO34591) (PE)
Sign In for Pricing
View Details 
LV795952 1.0 µg DNA
CDHR3 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)
Sign In for Pricing
View Details