Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Thymosin beta-10 (Tmsb10)

Product Specifications

Product Name Alternative

Tmsb10; Ptmb10

Abbreviation

Recombinant Mouse Tmsb10 protein

Gene Name

Tmsb10

UniProt

Q6ZWY8

Expression Region

2-44aa

Organism

Mus musculus (Mouse)

Target Sequence

ADKPDMGEIASFDKAKLKKTETQEKNTLPTKETIEQEKRSEIS

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

Plays an important role in the organization of the cytoskeleton. Binds to and sequesters actin monomers (G actin) and therefore inhibits actin polymerization (By similarity) .

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

17.8 kDa

References & Citations

"Fetal and trophoblast PI3K p110alpha have distinct roles in regulating resource supply to the growing fetus in mice." Lopez-Tello J., Perez-Garcia V., Khaira J., Kusinski L.C., Cooper W.N., Andreani A., Grant I., Fernandez de Liger E., Lam B.Y., Hemberger M., Sandovici I., Constancia M., Sferruzzi-Perri A.N. Elife 8:0-0 (2019)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Purified Anti-Mouse CD41 Antibody[MWReg30]
E-AB-F1183A-01 25 µg

Purified Anti-Mouse CD41 Antibody[MWReg30]

Sign In for Pricing
View Details
Purified Anti-Mouse CD41 Antibody[MWReg30]
E-AB-F1183A-02 100 µg

Purified Anti-Mouse CD41 Antibody[MWReg30]

Sign In for Pricing
View Details
AP180 (SNAP91) Human Gene Knockout Kit (CRISPR)
KN422020 1 Kit

AP180 (SNAP91) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MYOD1 pSer200 Rabbit Polyclonal Antibody
AP02375PU-S 50 µL

MYOD1 pSer200 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
5-Chloro-7-nitro-2(3H)-benzoxazolone
TRC-C373915-500MG 500 mg

5-Chloro-7-nitro-2(3H)-benzoxazolone

Sign In for Pricing
View Details
Adenosine A1 Receptor Recombinant Rabbit Monoclonal Antibody [JE31-35]
HA721393 100 µL

Adenosine A1 Receptor Recombinant Rabbit Monoclonal Antibody [JE31-35]

Sign In for Pricing
View Details