Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Protein S100-A6 (S100a6)

Product Specifications

Product Name Alternative

(Calcyclin) (Prolactin receptor-associated protein) (S100 calcium-binding protein A6)

Abbreviation

Recombinant Rat S100a6 protein

Gene Name

S100a6

UniProt

P05964

Expression Region

1-89aa

Organism

Rattus norvegicus (Rat)

Target Sequence

MACPLDQAIGLLVAIFHKYSGKEGDKHTLSKKELKELIQKELTIGAKLQDAEIARLMDDLDRNKDQEVNFQEYVAFLGALALIYNEALK

Tag

N-terminal 10xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

May function as calcium sensor and modulator, contributing to cellular calcium signaling. May function by interacting with other proteins, such as TPR-containing proteins, and indirectly play a role in many physiological processes such as the reorganization of the actin cytoskeleton and in cell motility. Binds 2 calcium ions. Calcium binding is cooperative.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

13.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Biotin Rat IgG2a, λ Isotype Control[B39-4]
E-AB-F09743B-01 25 µg

Biotin Rat IgG2a, λ Isotype Control[B39-4]

Sign In for Pricing
View Details
Biotin Rat IgG2a, λ Isotype Control[B39-4]
E-AB-F09743B-02 100 µg

Biotin Rat IgG2a, λ Isotype Control[B39-4]

Sign In for Pricing
View Details
HDAC6 (NM_006044) Human Over-expression Lysate
LY401822 100 µg

HDAC6 (NM_006044) Human Over-expression Lysate

Sign In for Pricing
View Details
CD3e (RIV9), CF647 conjugate, 0.1mg/mL
BNC470322-100 1x 100 µL

CD3e (RIV9), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Total Phenols Colorimetric Assay Kit (Plant samples)
E-BC-K354-M-01 96 T (40 samples)

Total Phenols Colorimetric Assay Kit (Plant samples)

Sign In for Pricing
View Details
Total Phenols Colorimetric Assay Kit (Plant samples)
E-BC-K354-M-02 500 Assays (242 samples)

Total Phenols Colorimetric Assay Kit (Plant samples)

Sign In for Pricing
View Details