IL-8/CXCL8, Rhesus macaque (His)
CXCL8 protein, a crucial chemotactic factor, drives inflammatory responses by attracting neutrophils, basophils, and T-cells, contributing to pathogen clearance. It plays a pivotal role in activating neutrophils and binds to CXCR1/CXCR2 receptors, initiating downstream signaling pathways. CXCL8 homodimerizes and interacts with TNFAIP6, potentially regulating chemokine activity in the inflammatory microenvironment. IL-8/CXCL8 Protein, Rhesus macaque (His) is the recombinant Rhesus Macaque-derived CXCL8 protein, expressed by E. coli , with N-6*His labeled tag.
Product Specifications
Product Name Alternative
IL-8/CXCL8 Protein, Rhesus macaque (His), Rhesus Macaque, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/cxcl8-protein-rhesus-macaque-his.html
Purity
95.0
Smiles
AVLPRSAKELRCECIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKEPWVQRVVEKFVKRAENQNP
Molecular Formula
613028 (Gene_ID) P67813 (A23-P101) (Accession)
Molecular Weight
Approximately 11 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Browse additional items from our catalog
OR7E99P sgRNA CRISPR Lentivector (Human) (Target 1)
ATG5/APG5L Monoclonal Antibody, PE-Cy5.5 Conjugated
Spectinomycin dihydrochloride pentahydrate (≥98.0%, ≥603μg/mg, BioReagent)
PLIN2 Recombinant Antibody, PE-Cy5.5 Conjugated